CAZyme Information: MGYG000000460_00677

Basic Information

• Species: CAG-475 sp900550915
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; CAG-475; CAG-475 sp900550915
• CAZyme ID: MGYG000000460_00677
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845		94151.38	4.8892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000460	1595400	MAG	Fiji	Oceania

• Gene Location: Start: 89922; End: 92459 Strand: -

Full Sequence      

MSFISKVVNLFSPTAQKSASDGNKMCVTSPIMRARARQAAEEGIVLVKNDGTLPIKSGEE
VAVFGRTQYDWFCVGYGSGGDVKAPYKVSFADGLKNESGIIINENLDKKYSEWCKQNVPD
EGFWGHWPFSFKEMPISENEIWDAAKTSDVAIITIGRAAGEDREQKLKDGSFYLTLDELK
LIDKVTAIFKKTVLVLDVGNVIDFEEIDKFGDRINAIVIAWQGGMESGHALCDVLSGKVN
PSGRLTDTIAVNYDAYPAHDFGHKDFNEYDEDVFVGYRYFETFAKDEVIYPFGYGLSYTT
FETSGSVEKTQDGVRVAVTIKNIGDVKGKTVAQVYVRKADGMLPKPARELVAFKKTVELE
SGEETSFTFDIGEYALSNYDDEGATGYKACWVLEYGDYEFFVGENVRDAQSIGIVQFDKK
VTSVCHTACSPSKDIRALFKYDSLDADMLKRADVTGRETFEEFMAKMNKLSEDELENFLS
NLENGMQSYGWKYHIVKGESGYLKERIESNMPKEIAHSDEKIDFKDVLDGKRSLDEFVAT
LSDEDLENLCHGDYRMNSPKGAVGNAGVFGGISESLAEKGVPTATTTDGPSGIRLCEKAS
LLPCGTCIASTWNESLAEQLYECVGDEMIEKGSDILLAPGMNIHRSMLCGRNFEYFSEDP
YLSGKTASAIVKGVQSRGVGSCIKHFACNNQERFRYVNDSRLTERALREIYLKGFEICVK
EAKPLCVMTSYNKVNGVYSYHNYDLCTTILREEWGFENMVMTDWWTKKAKNPLFKGVDDN
AYRVRAQADVLMPGGSRLGGKYDGSTLKSLKKGGLQCAELQRTAKNVLSVLKKLEINRIE
RGDTV

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	578	793	1.9e-62	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	3.36e-46	580	834	59	315	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.31e-40	44	277	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PRK15098	PRK15098	1.47e-38	29	411	380	759	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	3.39e-24	580	830	65	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	3.53e-18	23	404	384	770	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKJ18913.1	2.92e-258	37	829	43	801
AQX17210.1	5.20e-253	15	845	9	809
VEP40216.1	7.78e-253	15	845	21	821
AZS42860.1	5.42e-250	30	830	38	804
SCY66942.1	4.36e-249	30	835	38	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	9.32e-192	36	831	40	819	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	4.08e-62	563	831	23	304	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.99e-61	563	831	23	304	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	2.21e-48	566	831	18	286	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.36e-46	574	833	30	287	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	9.05e-176	35	831	12	762	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	5.18e-137	38	822	34	812	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
Q5BFG8	5.79e-52	573	834	35	289	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
F6C6C1	9.14e-48	574	833	30	287	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
P14002	1.21e-47	566	831	18	286	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000460_00677.