CAZyme Information: MGYG000000464_00791

Basic Information

• Species: QHMH01 sp003258795
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; QHMH01; QHMH01 sp003258795
• CAZyme ID: MGYG000000464_00791
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		41940.74	9.4097

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000464	1534068	MAG	Fiji	Oceania

• Gene Location: Start: 50925; End: 52022 Strand: +

Full Sequence      

MQTLEHAKRLISEIVIKIQFFIIQLYLFFLKFYIQFAQCYKKLYTKFMNDLFTKLNQMFI
FGFSNETEIENALKKGLGGVIFFTKNIQSDIQSVTKRIKSYSKISPFISIDEEGGRVERT
ENLFNGKKFLSANVVMQKGEDFAKQQTFEISMLLKKLGFNLNFAPVLDVNTNPKNPIIGE
RAFSNNTDEVIKFGKIVVDEYLRNGIIPCTKHFPGHGDAQKDSHLTLPEINLSLSNLEKN
HIRPFAEVKSPMIMIAHLHCKAFDKEKIPSSLSKNVLNYLRKNLNYDGVTISDDMVMGGI
TSAYNDIENAVKAIKAGINILLYRDCRPDVVEKVYELSKSDNDLRKNIEESYERIINLKK
QCKLL

Enzyme Prediction     

No EC number prediction in MGYG000000464_00791.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	102	322	2.1e-38	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.52e-61	54	365	6	318	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	8.39e-51	54	358	5	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.53e-33	78	334	27	289	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38577.1	4.36e-118	48	365	1	323
SNV85594.1	7.47e-56	54	364	65	389
CDI50326.1	1.31e-55	54	364	60	384
QIB69696.1	5.73e-55	66	365	88	396
SHD77665.1	9.71e-55	54	364	68	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	8.96e-43	54	322	16	297	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3TEV_A	9.06e-42	76	321	43	290	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
3BMX_A	1.42e-37	68	359	76	393	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	5.68e-37	68	359	50	367	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	7.04e-37	68	359	80	397	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48823	1.61e-43	77	322	64	334	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
P40406	7.75e-37	68	359	76	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
A9M1Z4	9.58e-31	66	336	22	300	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=nagZ PE=3 SV=1
P44955	1.54e-30	66	342	15	297	Beta-hexosaminidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nagZ PE=3 SV=1
Q9JVT3	1.84e-30	66	334	22	298	Beta-hexosaminidase OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998393	0.001460	0.000027	0.000007	0.000004	0.000104

TMHMM  Annotations     

start	end
20	37