CAZyme Information: MGYG000000464_00803

Basic Information

• Species: QHMH01 sp003258795
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; QHMH01; QHMH01 sp003258795
• CAZyme ID: MGYG000000464_00803
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
222		23997.6	10.125

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000464	1534068	MAG	Fiji	Oceania

• Gene Location: Start: 63754; End: 64422 Strand: -

Full Sequence      

MFTGMLQSLLSSSGQEAAIRRASQLQTYTNNIDKPQAPVYPTPNPVQTIHTTSFKDVLSS
TQKADFGSLTGLNSIPVKNVQAEIATTKTKPELRTSADKAYIMDLVSKVSKKHGVDEKLV
KALIKQESGFNPKAKSRVGAMGLMQLMPATAKGLGVKDPFNPVDNVEGGVKYLKSMLNRY
NGNVILALSAYNAGPGAVDKYDGVPPYAETQNYVKKILANYL

Enzyme Prediction     

No EC number prediction in MGYG000000464_00803.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	118	221	6.9e-36	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.40e-56	117	221	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.79e-55	104	221	8	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.66e-48	104	221	6	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.66e-39	108	201	3	102	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	2.09e-35	108	221	3	156	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38062.1	5.96e-76	1	222	1	238
QNF30947.1	9.29e-55	104	221	30	147
ASS92357.1	4.83e-54	53	221	4	166
QGQ48609.1	1.04e-52	81	221	74	209
QDK69812.1	1.14e-52	82	221	38	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.15e-16	104	220	418	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.15e-16	104	220	422	555	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.15e-16	104	220	428	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	1.16e-16	104	220	438	571	Lytictransglycosylase in action [Neisseria meningitidis]
5O24_A	1.16e-16	104	220	432	565	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.98e-50	58	221	18	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	4.33e-40	106	221	1426	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	4.33e-40	106	221	1426	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	2.80e-18	104	220	9	118	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
P39434	1.20e-15	104	219	482	620	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000464_00803.