CAZyme Information: MGYG000000467_00693

Basic Information

• Species: CAAGED01 sp900768505
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; CAAGED01; CAAGED01 sp900768505
• CAZyme ID: MGYG000000467_00693
• CAZy Family: GH37
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		59407.59	6.1985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000467	2445290	MAG	Fiji	Oceania

• Gene Location: Start: 20638; End: 22182 Strand: -

Full Sequence      

MKPKNFDIHNSDYFNEVPLPVFDENPEYIDFYRRAWQIIRDHVKEIPGMPQTPYMDEAFI
ETDIWIWDTCFMMFFCKYAPNVFPGIETLNNFYQPLLDNKPLPVLTVSQDLPDWTGLKKG
EKTQLKIHIPDNPPLFAWAEYSYALMTGDKEHLKKLLLQDRYLQRHYEFFDNFTEPGYVT
KYTRAPSCLIKMEDGYLWEGGRSGMDNTPRGRLNGKAGAIERPNHPRMLWVDAISQQALS
AYCISKIADLLEERDLVAEWTKKYEVLKEKINRIYWDEADSIYYDVHNDTREFMKCVTPA
SFWPLLANIPSSEQVDKIIRYITNPNKLGGSVPWVTLARDDADFNAEHGHYWRGAVWLPT
AYMGIKGLENYGKFDLANDSARKILNHMFQTWKNYEPHTIWECYAPNSYRPAQHGSERVR
PDFCGWSGLGPAALFIENVIGIYSANAFTNVVKWALPPVIKGKLGIKNYSFGDVVFDAVY
ENGVISVKSNQPFTLEVNGKAHKINTGVSSFDVK

Enzyme Prediction     

No EC number prediction in MGYG000000467_00693.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	244	427	3.2e-21	0.35234215885947046

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	1.48e-19	244	414	591	775	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	8.74e-16	151	429	186	487	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG3408	GDB1	2.80e-14	131	477	339	639	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	4.86e-12	244	395	318	466	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	6.73e-10	244	427	367	541	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44762.1	4.09e-212	1	507	84	589
QZT38129.1	5.68e-171	18	513	33	502
AOW82330.1	4.54e-156	9	513	37	514
QWP09187.1	5.39e-152	10	507	2	470
QWP15489.1	5.39e-152	10	507	2	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	5.15e-11	231	414	551	748	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	5.15e-11	231	414	551	748	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7X_A	5.15e-11	231	414	551	748	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	5.56e-11	231	414	100	297	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	5.56e-11	231	414	100	297	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	1.65e-33	21	457	9	408	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P42592	2.86e-10	231	414	574	771	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
P52494	3.37e-08	260	458	689	890	Cytosolic neutral trehalase OS=Candida albicans OX=5476 GN=NTC1 PE=1 SV=1
P49381	2.19e-07	259	467	533	754	Cytosolic neutral trehalase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=NTH1 PE=1 SV=1
Q13724	5.21e-07	203	429	580	828	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000467_00693.