CAZyme Information: MGYG000000467_00815

Basic Information

• Species: CAAGED01 sp900768505
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; CAAGED01; CAAGED01 sp900768505
• CAZyme ID: MGYG000000467_00815
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
943		107573.91	5.7643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000467	2445290	MAG	Fiji	Oceania

• Gene Location: Start: 73462; End: 76293 Strand: +

Full Sequence      

MKWDAKWIWLPEDCGTNYNTMLEFKKEFNVDNEIDSAELSITADSRYRVKINGVWINDGP
ARAYVQHYKFDRYQIGQFLQKGVNRIEGTVQFFGCGTFHQKPQRGGLLAQIILHFSDRHK
TTIASDESWQIRPAAAWVSNTPKISVQQPPVEIFDATRSNQSPWQNAAVICNAESGPWQE
LKERDCEFMSLEKVDLKKFIGASERCNNYLYFNWSPRKILLPGSFSNNCSDCYPAAFALI
LEVSNASTLKFVLSGVSIYIDGKKLGEDLQICLPIGSHTMLAFQSGNWPHAKDCTVFISG
TQDVKPVNPFGSNNEYSLITAPEHLRESPDIPFLWASKIHAKNTEFLAEWGKKLGESFTN
TDNLFRIARGTIIQVAKNEFFCDDGFFATRELTRQPLPAQYLKNPEALLNSDTKNYTAIS
CHNLCSSELCYDFTRQCCGYYQLEVESEYDGTIIDLYMVEYIDDKGNIQHTYEHHNTMRY
ICRKGINKFVSFRRRSGRYLFVTVSNCHAPLKIHHIGMIESTYPAQSFGTFNCSDDIFNQ
IWQMSANTLKLCMEDTFTDCPLYEQTLWVGDARSEALFAYGIFGAYDLSRRCIKLTAESL
EEFPIAGCQVPSCWECLLPAWSFMWGMSVYDYYFETGDLEFCRSVWPQAATNIIHSFAML
NSENGLFSAEAWNLFDWSPTNCAHSTMLYNSMFLYGATDAALKLAAALGENQFITEFTPK
NQQLKKDIQKFYDPERKMFPDWVEKEHHCPDGAVHTSMLALLYGLDEQANREDLINNIIS
RRNDLIQVSSPFASFYHYLAMVKIGAPEQVLSSIHQDYAEMVRRGESTVWETYIPLDFTD
GFPTRSHCHGWSAVPLYMLQELVLGIRLTAPGASKIEVSPVIANGLYRATGRRKTVNGLI
EVDWHIENNTLAVNIKKPANVEVTFKRNSSMKDLAEQVTISDF

Enzyme Prediction     

No EC number prediction in MGYG000000467_00815.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	426	924	6.2e-95	0.9821428571428571
CBM67	5	178	2.7e-32	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.76e-22	529	859	4	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.30e-06	865	924	1	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44894.1	3.68e-237	1	934	1	924
AMV40823.1	5.63e-218	5	928	37	961
QHI68391.1	2.03e-207	1	931	2	936
AQQ70857.1	3.11e-198	5	934	3	933
QHI68521.1	7.52e-198	1	940	1	915

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	5.30e-119	2	923	5	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	3.51e-29	487	913	263	683	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6I60_A	2.05e-10	526	922	463	893	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6T0Q_A	3.52e-06	5	178	33	184	PleurotusOstreatus Lectin (POL), apo form [Pleurotus ostreatus]
6T1D_A	3.56e-06	5	178	36	187	PleurotusOstreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_B Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_C Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_D Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_E Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_F Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	8.78e-08	526	930	487	909	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000467_00815.