CAZyme Information: MGYG000000467_01559

Basic Information

• Species: CAAGED01 sp900768505
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; CAAGED01; CAAGED01 sp900768505
• CAZyme ID: MGYG000000467_01559
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528		60955.29	7.5818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000467	2445290	MAG	Fiji	Oceania

• Gene Location: Start: 21959; End: 23545 Strand: -

Full Sequence      

MKLDDLTAEFLKKHPESCAALPINRYQKIKMALILLALVFLLLYRWDYFMLTISLFMIIV
YLASGIFRVTASVLSLKKCGILPTPPERIQALTDEDLPVYTILLPLYKEANIAEKIMRSI
AKLDYPHEKLDVKILLEADDHETINAVYAGDLQSWCDVIVVPDFKPKTKPRACNFGLQAA
KGEFCVIFDAEDIPEPDQLKKAVAAFRDDRQNQYACVQAKLNYYNAKYNLLTKLFTIEYS
TAFDLTLPGLSKLGVPLPLGGTSNHFRTDVLKKLGGWDPFNVTEDCDLGIRIYELNYHTA
VIESTTWEEANCQVWNWIRQRSRWVKGFIQTHYAHCRNNISLLRRLGLWGYFGFLMMVGG
SSFMILVNLIFWLAMTIYAVLAIHAMCNGVEFMEIIRGPQFFKEYQGMQIGPFQLRAWPL
FYWGAEENSLSAGWSVSMFIISLALFFNNFIFIGIHIAACVRRKFNYLICYALLMPFYWL
MISVAGWKGFWQFFTKPFYWEKTLHGLHDDNLIQSNHFQAGDLQNDKI

Enzyme Prediction     

No EC number prediction in MGYG000000467_01559.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	100	326	2e-28	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06427	CESA_like_2	3.60e-149	98	338	1	240	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
COG1215	BcsA	8.33e-52	48	422	13	382	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	8.51e-41	102	285	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06437	CESA_CaSu_A2	1.18e-25	98	328	1	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06421	CESA_CelA_like	1.04e-23	98	331	1	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44806.1	2.67e-203	2	510	7	515
AJY77762.1	1.33e-125	61	507	333	746
BBB47506.1	8.16e-124	3	515	849	1318
BBI30705.1	4.24e-122	3	515	199	680
ABD01671.1	6.07e-122	87	507	372	748

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	2.34e-09	98	310	42	247	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	2.35e-09	98	310	43	248	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5EJ1_A	4.52e-06	83	330	113	377	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.67e-06	83	330	125	389	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.67e-06	83	330	126	390	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	4.62e-22	95	327	46	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q9ZQB9	3.01e-15	81	330	219	479	Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1
Q6L538	2.64e-13	80	349	207	485	Probable xyloglucan glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC7 PE=2 SV=1
Q9SB75	2.65e-13	96	349	225	482	Probable xyloglucan glycosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=CSLC5 PE=1 SV=1
Q8LIY0	3.50e-13	76	349	201	488	Probable xyloglucan glycosyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999993	0.000018	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
29	46
50	72
348	370
430	452
465	487