CAZyme Information: MGYG000000467_01587

Basic Information

• Species: CAAGED01 sp900768505
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; CAAGED01; CAAGED01 sp900768505
• CAZyme ID: MGYG000000467_01587
• CAZy Family: GH63
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428	MGYG000000467_28|CGC2	49215.08	6.2459

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000467	2445290	MAG	Fiji	Oceania

• Gene Location: Start: 24945; End: 26231 Strand: -

Full Sequence      

MSEAINLANFDEKFMREFYEAALQIAEKKIQEGEAYLRDNPPSRKLLPRIATGGGFSGLF
LWDSAFCCIWAKHEPKRFPITTTLDNFYLLQDEDGYICREFQADGKPYWSRKHPVSFNPP
ILSWAELELFEHGVTDVERLKKVFPHLKKHFDFCWRNYRRSEDGLFFGDALGSGMDNLPR
QPIGCDFDIHGGIDIKLEHVLADNKRIWEMLKTRTLYCWNRQMGWIDYSSQMAFNAANLA
KIAAAIGAEDEAIRLRDKFAEMKQIINEQCYDPERGFYFDCYKGEVIPRYHAGAFWALLS
GIVPAERVEAVCRVICDEKIFNRPIPFPSLAACEKEYDPENGYWLGSSWPPTTYVGIRGL
QAMGRGDLALDFARRYYNANAELFRVSGTVWENISPEQCRQPKGHSGSSFCGWGALAPVA
IYKEFLQK

Enzyme Prediction     

No EC number prediction in MGYG000000467_01587.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	61	426	1.7e-22	0.35964912280701755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	1.32e-15	247	428	599	786	alpha-glucosidase; Provisional
pfam01204	Trehalase	9.53e-07	263	392	342	471	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	3.57e-05	266	376	394	499	Neutral trehalase [Carbohydrate transport and metabolism].
PRK13272	treA	0.005	263	392	377	500	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44932.1	7.43e-121	17	427	6	409
AVI50514.1	8.66e-96	19	426	53	459
AXT61762.1	1.14e-89	16	427	75	484
QIN83484.1	1.44e-65	47	426	68	435
BBL10718.1	3.44e-62	59	426	117	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	9.32e-16	226	428	551	759	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	9.32e-16	226	428	551	759	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	1.02e-15	226	428	100	308	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	1.02e-15	226	428	100	308	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]
7Q6Z_B	1.02e-15	226	428	122	330	ChainB, Megabody 177 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	5.19e-15	226	428	574	782	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999859	0.000134	0.000012	0.000001	0.000000	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000467_01587.