CAZyme Information: MGYG000000467_01884

Basic Information

• Species: CAAGED01 sp900768505
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; CAAGED01; CAAGED01 sp900768505
• CAZyme ID: MGYG000000467_01884
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000000467_39|CGC1	44073.9	9.5389

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000467	2445290	MAG	Fiji	Oceania

• Gene Location: Start: 18122; End: 19294 Strand: +

Full Sequence      

MKKKKIWIFAGETSGDMYGARLAVELRKIAAERNEEVEISGMGSHKMRQAGVNIILDSSE
LDVMGLIEVLKHIFTFVKIFYRLLKQVKSERPDALVLIDYPGFNLRFAAKLFGSKIPVIW
YISPHVWAWGKGRVPKLGKFCKKILLIFPFEVDFYRQHRVENACFVGHPLMEILHEKRDL
SLARDNNLILLLPGSRSMEIKSLLLPMLESALELKRRHPELKFVLPAPRENICNLCKKIY
ADFCAVHPEGKSINLEFAIGNTHYYQQLSVAAFAASGTVTLESAIMDMPLIAMYKLNWIT
ATLAGLLVKLKYYAMPNIVADKEIFKEVYQFGLNKETLVPEMEAILPGGSRRAEVESGMA
EVRAKLSLSDGQQPLNAAAREIYQTAVGSR

Enzyme Prediction     

No EC number prediction in MGYG000000467_01884.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	6	366	8.9e-103	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.10e-109	4	382	2	371	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.48e-99	4	366	2	362	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.17e-74	6	347	1	337	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.42e-68	6	347	8	343	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.58e-51	4	338	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH40861.1	2.97e-136	2	367	4	368
AVM45461.1	3.37e-132	3	377	11	387
QJW49207.1	1.86e-69	14	386	11	374
ACH37867.1	2.52e-68	2	366	4	362
BCG48537.1	2.52e-68	2	366	4	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.21e-39	6	377	9	376	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.32e-39	6	377	9	376	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1INL4	9.98e-66	5	386	3	378	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
B8JE78	5.72e-61	5	378	10	375	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	8.04e-61	5	378	10	375	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
B3E4H8	1.13e-60	2	366	5	363	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q2IL69	3.14e-60	5	378	10	375	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000467_01884.