CAZyme Information: MGYG000000468_01788

Basic Information

• Species: UMGS1696 sp900554225
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1696; UMGS1696 sp900554225
• CAZyme ID: MGYG000000468_01788
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	MGYG000000468_57|CGC1	38219.19	8.7085

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000468	2935049	MAG	Fiji	Oceania

• Gene Location: Start: 15374; End: 16402 Strand: +

Full Sequence      

MTVRRKAATMNLNKQFLTENECYRTGRKHTVKGIMVHSTGCNQPNLDVWYRLWNQPRPGG
RQVCVHAFVGRLADGSIGTYQTLSWDMVGWHSGSGSVGNANFMGCIGFEICEDDLTDRVY
FEKVYREAVELCAYLCKQYGLTEKNIICHYEGYKQGIASNHGDVMHWFPKHGKSMDTFRA
TVKELLATETKSDTDTEKETLAETTTTEYPAKLTSGYYRVRKTWKDSKSQVGAYRILKNA
KAKADENEGYCVFDNDGNVVYAPSATKAETKTEVALEPYRVRICITNLNIRKDPGTNYGK
TGQFTGAGVFTIIAESDGTGASKWGKLKSGAGWISLNYAAKL

Enzyme Prediction     

No EC number prediction in MGYG000000468_01788.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06583	PGRP	2.24e-23	31	155	2	119	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
pfam01510	Amidase_2	4.88e-18	30	151	1	112	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
smart00644	Ami_2	2.01e-13	29	151	1	119	Ami_2 domain.
COG5632	CwlA	0.002	65	150	55	141	N-acetylmuramoyl-L-alanine amidase CwlA [Cell wall/membrane/envelope biogenesis].
pfam08239	SH3_3	0.008	286	338	1	52	Bacterial SH3 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDM67796.1	1.98e-118	10	266	1	260
QAT44066.1	2.05e-116	10	285	1	274
AOT72278.1	3.91e-98	10	273	1	267
AEY67694.1	5.02e-92	10	274	1	254
QBF75599.1	5.84e-80	4	342	168	499

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000468_01788.