CAZyme Information: MGYG000000470_00770

Basic Information

• Species: Brachyspira pilosicoli
• Lineage: Bacteria; Spirochaetota; Brachyspirae; Brachyspirales; Brachyspiraceae; Brachyspira; Brachyspira pilosicoli
• CAZyme ID: MGYG000000470_00770
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42494.62	8.7338

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000470	2694868	MAG	Fiji	Oceania

• Gene Location: Start: 8082; End: 9203 Strand: +

Full Sequence      

MRIFIATGEVSGDIQGALIANEIKKLAPQTIIDGFGGVEMKKANVNILSDMSTLSTMGIF
EGINPKFAFKKLGAFNILKEYLKNNKVDVMLLVDNQGVNLILAKYCKKNNIPYIYYFPPH
VGIWGEWNAKRLLSAKKIITPFQFDYDVYKKYNCNVVYSGHPFADINYNREVSPLNMDKK
EYTVGVLFGSRYQEIKKLAPVFIKSMKILNDMLFGNIRFIIPVAYPEYREPIENIIDNYK
DLLNGICYSVIENKDDVYIYSDALIMSSGTASLIAACYGKPMVICYKISHLTFLLGKFFT
NIKYVGMPNVMLNEEAAPELLQRDCNPNAISSHIIKYLTDKEYYDKTSSNLIRVRELLGD
KNVLERVAKEIIN

Enzyme Prediction     

No EC number prediction in MGYG000000470_00770.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	357	7.5e-88	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.68e-96	1	373	2	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.30e-84	1	372	2	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.14e-64	3	371	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	2.70e-29	48	373	42	346	lipid-A-disaccharide synthase.
PRK01021	lpxB	8.73e-09	4	334	230	566	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGA67412.1	2.69e-278	1	373	1	373
CCG57553.1	3.82e-278	1	373	1	373
ADK30769.1	3.82e-278	1	373	1	373
AFR71484.1	1.10e-277	1	373	1	373
ADG71199.1	1.23e-229	1	372	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.22e-33	1	340	7	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.08e-33	1	340	7	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0QR27	8.71e-57	2	368	3	370	Lipid-A-disaccharide synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) OX=123214 GN=lpxB PE=3 SV=1
Q74AT9	1.39e-56	2	368	8	373	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B2V704	6.44e-55	2	368	3	376	Lipid-A-disaccharide synthase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) OX=436114 GN=lpxB PE=3 SV=1
Q39T49	3.18e-54	2	368	8	373	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B6J161	3.22e-51	3	373	6	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000470_00770.