CAZyme Information: MGYG000000470_02371

Basic Information

• Species: Brachyspira pilosicoli
• Lineage: Bacteria; Spirochaetota; Brachyspirae; Brachyspirales; Brachyspiraceae; Brachyspira; Brachyspira pilosicoli
• CAZyme ID: MGYG000000470_02371
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		37158.2	9.1047

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000470	2694868	MAG	Fiji	Oceania

• Gene Location: Start: 1526; End: 2506 Strand: -

Full Sequence      

MKILIIGMNYIGDTIFITPIIRAIKKHYGENCTVDVINGSRGIDILKENPYINNIIVRDE
NNLEFIKKENYDIGFAANTSFVSASILKKANIPVRVGVNSECRGFLLTHKTSWKKHSRHI
VDTILSILKPLNIKDDGFYTELFLSKEEEAFGYNKMKDYKNALIVHGGATRISKRYTHFV
ELIKEFKKEFNDVPVIIIGSKDDASFANTMKENINDIIDFTDKLTIRELISVIKYSYALI
GGDSAPLHIANALGIYSIGIFGDTLPLIYGVRGDKAFNIEAREKYCNKIKSFHCEYIKRG
CKTIDCLNKLDYRDILPYLVSIYKKI

Enzyme Prediction     

No EC number prediction in MGYG000000470_02371.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	66	296	1.9e-36	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.25e-45	1	266	2	282	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	8.61e-44	2	311	1	267	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	1.19e-16	2	264	7	291	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	7.85e-15	66	279	8	227	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADK30478.1	5.72e-238	1	326	1	326
AGA65489.1	1.15e-237	1	326	1	326
AFR70259.1	1.64e-237	1	326	1	326
CCG57234.1	4.70e-237	1	326	1	326
AEM21447.1	2.27e-169	2	326	3	329

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	1.05e-13	8	264	1	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	1.33e-10	8	264	1	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P37692	6.57e-07	1	266	1	292	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P37421	1.17e-06	1	266	1	292	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000470_02371.