CAZyme Information: MGYG000000471_00233

Basic Information

• Species: UBA7642 sp900770925
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-288; UBA7642; UBA7642 sp900770925
• CAZyme ID: MGYG000000471_00233
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		49406.19	10.0977

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000471	1588654	MAG	Fiji	Oceania

• Gene Location: Start: 57861; End: 59144 Strand: -

Full Sequence      

MVITLVIDIFGDPNNGTTVTARRTASYLQDLGNEVRIIGWISPKSEPEFLKRFKILSCRK
NKISDISVISDNGFTFGTATEKEIADFIKGSDVVHLFFPFPLEAKARKVAKAMGIAVTSA
FHVQPENISFNIHRGKIALVNLIIYKLFKNWLYKYTRSIHTPSESRRDLRVEHHYPNEIY
PISNGMVPRFHPEKVEKPESRKDKFVILMIGRLAREKRQDIIIKAIGKSKYNKNIQLILC
GQGPKKKYYQKLSKKYLANPCIFEFVNQKKLCDIINFSDLYIHASDAESEAIACIEAFAC
GKVPVISDSKYSATNHFALDKRCLFKAGSPESLKEKIEYFYEHPEVRPSLSEKYIEFAKT
FDINNKVKELYQRRQNEYNKNEEDIKLGRTYYTSRAERRHLKKTAKKAGIENPYLAKKDI
YHHKKSK

Enzyme Prediction     

No EC number prediction in MGYG000000471_00233.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	200	349	3.1e-26	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03817	GT4_UGDG-like	1.44e-58	6	373	1	371	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
cd03801	GT4_PimA-like	3.82e-34	3	372	2	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.57e-31	1	372	1	372	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	1.71e-24	203	359	1	156	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03794	GT4_WbuB-like	9.86e-23	3	353	2	372	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADO38766.1	1.17e-94	1	378	1	374
QCT71572.1	1.17e-94	1	363	1	356
ALU13529.1	1.17e-94	1	363	1	356
ARD65372.1	2.24e-92	1	370	1	363
AEF80783.1	5.83e-87	1	370	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QHP_A	1.06e-33	205	367	3	164	Crystalstructure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori [Helicobacter pylori 26695],3QHP_B Crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori [Helicobacter pylori 26695]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6ZW78	4.69e-07	176	300	177	301	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=SPT14 PE=3 SV=1
B3LKQ3	1.92e-06	176	300	177	301	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=SPT14 PE=3 SV=1
B5VSZ6	1.92e-06	176	300	177	301	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=SPT14 PE=3 SV=2
P32363	1.92e-06	176	300	177	301	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT14 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000015	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000471_00233.