CAZyme Information: MGYG000000476_00631

Basic Information

• Species: UMGS882 sp900546385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS882; UMGS882 sp900546385
• CAZyme ID: MGYG000000476_00631
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660	MGYG000000476_4|CGC1	75951.15	5.6349

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000476	2809926	MAG	Fiji	Oceania

• Gene Location: Start: 5941; End: 7923 Strand: -

Full Sequence      

MQDFEAKWITCQAFCALEPLNVFHKENDDVKIPENEAYQNKHILFRRTFSLPEFGKAILR
ISADDYYKLYINGRFVTQGPAPGYPFHYYYNEIDVTRYLHPHTNVIAVHTYYQGLVNRVW
VSADLRQGLACELFLDGKQVLTSDGTWKCAYHTGFSACGKFGYDTQFAECYDARAAECGF
SQPEFDDSVWENAHFRAHADYIMFRQPTEQLAFCDVKPKELRKTPNGLFIDFGFEAVGYL
TFRASGKKGDTLTLRFGEELNDDGSVRYKMRCNCDYEEKFILSGKNADELNEYDYKAFRY
AELELPDGVTVDTDSIRFVVRHYPFREIKHYTGTNQKLAVIYKLCSDTIKYGVQECFVDC
PTREKGQYLGDVTIAGLAHASLTGDPSMIRKALENYTQSTFICKGLMTVAPASLMQEIAD
YSLQFPFQVLWYYRFTGDKAFLRQMYPYVRGVCEFFADYRRENGLIENVKAKWNLVDWPA
NLRDNYDFPLEKLIGEGFHNVINAFYVSMLGHADEIARILGEQPTGLYENTKKAYIDAFY
DKEQKLFVDSIGSRHASFHSNVIALFGGIWTDEENKRAMINLIRAKKLTCAGVYMAFFAL
YALKECGEKKLMETLIADDGAWMNMLDEGATTCYEAWGKEQKWNTSLFHPWASAPAILLD

Enzyme Prediction     

No EC number prediction in MGYG000000476_00631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	225	657	3.3e-84	0.8492063492063492
CBM67	33	195	6.6e-40	0.9090909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.42e-26	335	656	10	333	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.24e-15	56	198	5	155	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.83e-14	222	312	1	94	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	3.51e-05	420	550	99	209	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
pfam06202	GDE_C	0.004	419	566	83	241	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH20286.1	7.21e-202	1	659	2	667
AVM43798.1	3.34e-200	2	649	73	722
QCT01521.1	2.19e-198	4	659	5	666
QNK58911.1	3.34e-196	6	659	7	681
AFH60330.1	2.73e-193	4	660	5	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.33e-19	133	659	119	632	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6I60_A	1.14e-15	2	639	143	809	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
2OKX_A	1.51e-15	228	659	439	872	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6GSZ_A	8.98e-14	40	637	129	742	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
4XHC_A	4.28e-13	226	656	93	535	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	1.92e-27	216	656	595	1065	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
T2KNB2	2.20e-19	3	642	148	786	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	9.07e-16	45	582	187	749	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000476_00631.