CAZyme Information: MGYG000000477_00507

Basic Information

• Species: UBA1234 sp900753135
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; UBA1234; UBA1234; UBA1234 sp900753135
• CAZyme ID: MGYG000000477_00507
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		47902.21	9.0995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000477	1717685	MAG	Fiji	Oceania

• Gene Location: Start: 53995; End: 55224 Strand: -

Full Sequence      

MKIGILLLTMQVILFYILMFFWVYQLFICIFAFIHEKKKERIIEKNHKFMAVVSARNEEN
VIGNLIESLKEQTYRYVDIYVIADNCNDKTAKVARLHGATVYERFDKNKRSKGFALEWFF
EKILSEKPNEYDAFCIFDADNIVSNDFFEKMNTKLCEGEKIVQGYRDISNPGDTWISANY
AIFYWTMNRCYHYTRYKLGLSPLINGTGFMVSMDILKEKNGWHSDTLTEDIEFSIENIIK
NHKIGWAQDAVVYDEQPLKFKQSFRQRLRWSVGHLQCFQKFIHEFLTLGKFNATIIDTLI
YTLGMPMILLSVIITIIDIIKVLFIRQFNYTTLIGGLKFTALTIFISMLQALIITILEKK
SVKKVWKGIATYPIFLVSWFVINIMAFFNKNLEWKPITHLGSGNVKEAS

Enzyme Prediction     

No EC number prediction in MGYG000000477_00507.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	49	273	7.5e-26	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	1.63e-77	52	233	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	3.32e-39	52	230	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	7.42e-38	5	388	8	398	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	1.28e-20	49	271	4	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam13632	Glyco_trans_2_3	2.26e-13	138	312	6	183	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT55360.1	3.64e-111	24	409	24	414
BCI60981.1	5.15e-104	21	399	22	404
ACA55073.1	6.84e-98	16	407	17	419
AUN03940.1	1.37e-97	16	407	17	419
ADG00238.1	1.37e-97	16	407	17	419

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	5.85e-12	24	290	19	296	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8YMK0	3.34e-07	32	276	90	336	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	5.87e-07	52	276	111	336	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
P74165	2.44e-06	52	276	113	338	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.968903	0.028444	0.000995	0.000119	0.000087	0.001466

TMHMM  Annotations     

start	end
12	34
303	325
332	354
369	388