CAZyme Information: MGYG000000477_00771

Basic Information

• Species: UBA1234 sp900753135
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; UBA1234; UBA1234; UBA1234 sp900753135
• CAZyme ID: MGYG000000477_00771
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235		27247.5	5.8167

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000477	1717685	MAG	Fiji	Oceania

• Gene Location: Start: 4942; End: 5649 Strand: -

Full Sequence      

MWKKIKFLLKLCLILIIITCAFYVYSGYKVYEEAIIDMPIDEKIEEIKSNENYTKLDEMP
SMYKEAVIAVEDHRFYMHNGIDVISITRAIINDVKAMSFVEGGSTITQQLAKNVYFTQEK
KLTRKIAEVFMAFAFEKKCTKNEILELYLNSSYFGDGCYSVSEASRHYFNKEPINMNDYE
CTLLAGIPNAPSVYAPTKNPKLAKQRQRQVLDKMIEYGKISVEYANEILENSYEN

Enzyme Prediction     

No EC number prediction in MGYG000000477_00771.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	44	214	1.7e-63	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	2.82e-81	50	214	12	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	3.70e-74	53	227	4	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.56e-68	53	221	78	247	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.87e-64	53	227	69	243	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	8.80e-43	54	231	61	237	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB42272.1	2.69e-81	27	225	36	234
ANU54501.1	2.69e-81	27	225	36	234
QQR31552.1	2.69e-81	27	225	36	234
QNM09777.1	4.07e-81	8	229	20	241
QRP41835.1	4.31e-79	26	229	28	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	2.64e-41	53	227	22	196	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.05e-40	53	227	22	196	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	4.64e-34	42	214	48	226	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	5.06e-34	42	214	12	190	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	5.19e-34	42	214	13	191	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	2.20e-44	38	230	34	226	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
P38050	4.70e-43	35	225	51	241	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O87626	1.77e-42	53	230	70	247	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
O87579	1.04e-40	53	229	70	246	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P0A0Z5	1.04e-40	53	229	70	246	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.805566	0.066508	0.125486	0.000328	0.000183	0.001941

TMHMM  Annotations     

start	end
7	26