CAZyme Information: MGYG000000479_00269

Basic Information

• Species: Treponema_D sp900541995
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900541995
• CAZyme ID: MGYG000000479_00269
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291	MGYG000000479_1|CGC5	33370.66	9.667

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000479	2347794	MAG	Fiji	Oceania

• Gene Location: Start: 301960; End: 302835 Strand: +

Full Sequence      

MLHKKRCIFFLCLIAFSTLFAEGPRRKKLELPGADSPLTKKYRDNYLTDAGRKWLREVLY
NSAPYRPYIRAQLKKRRLPMILQYLPIVESDYKVHAVSKSGAAGMWQFMENSMSPYLKKN
YWYDERFDPWKETDAALSKLADNYKMFGDWSFALAAYNMGAGAISRTIKEHPGKTYWNLA
ENGDIRSQTAMYVPKLLAVADIIENAEYYGLIDIGAIDKMIEGKAPEQYSYLRITGKISL
SEIAAATGIDLETLIFLNPALLHECTPSKETYRLRLPYGSAKKAAEDLKRR

Enzyme Prediction     

No EC number prediction in MGYG000000479_00269.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	67	208	4.4e-21	0.9259259259259259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.58e-52	73	201	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	2.79e-40	28	259	71	293	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	3.94e-26	69	179	2	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	3.95e-09	88	171	10	92	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	6.00e-08	64	197	3	141	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA01417.1	1.32e-214	1	291	1	291
QOS41111.1	8.22e-117	16	290	67	343
AEB13823.1	3.78e-116	24	289	64	329
AEE16302.1	2.39e-84	26	279	107	355
QTQ11115.1	1.78e-79	27	286	72	333

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	6.24e-29	28	258	68	289	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	6.24e-29	28	258	68	289	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	7.16e-16	46	174	10	136	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000384	0.998738	0.000301	0.000185	0.000188	0.000166

TMHMM  Annotations     

start	end
7	24