CAZyme Information: MGYG000000480_00157

Basic Information

• Species: CAG-312 sp900546565
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900546565
• CAZyme ID: MGYG000000480_00157
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000000480_3|CGC1	39577.76	9.5774

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000480	1940095	MAG	Fiji	Oceania

• Gene Location: Start: 29927; End: 31015 Strand: +

Full Sequence      

MSKFIIACGGTGGHLVPGIAIGQALIAAGHTVSFAISKKQVDSRLVEKYTNLHFIKMPGA
AFSKNPLKFLRFVKEFFNALYAGYRVLTNGKYDVVISFGGFNSLGISLAAAALGKPIVLH
EANRRTGKATRLLGYFAQRVYVPFGVSIPRRKINQVKFAGYPLREEIRRTDKGEAKKLFG
FPPEARILLVLGGSQGARALNDWAANEFDNLARENIDVLCVCGQNKKSYPERETPSKDGT
PRKIKMLDFCDNMAAALSAADLVVARAGAGTIAELARCAVPSIMVPYPFAADNHQLENAK
CFEKQGACSVVEQKDLDKLFTEVVSLINNETLKEAMRKNLARVDEQNDCSRIVEDLTQIA
GD

Enzyme Prediction     

No EC number prediction in MGYG000000480_00157.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	188	344	6.1e-47	0.9617834394904459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03785	GT28_MurG	1.58e-104	3	354	1	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	2.57e-96	1	361	1	356	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
TIGR01133	murG	6.00e-81	2	354	1	346	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	1.12e-79	3	343	2	338	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	1.21e-35	187	341	1	156	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY35776.1	1.87e-111	1	360	1	360
AOS46406.1	1.60e-102	1	360	1	360
AWT60195.1	5.00e-101	1	360	1	361
AWI07981.1	6.27e-99	4	359	13	368
QYM78081.1	1.18e-98	1	359	1	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	4.77e-36	3	360	8	354	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	6.74e-33	10	358	18	363	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	8.72e-30	5	314	6	307	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1ZU31	1.14e-89	1	359	1	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1) OX=452637 GN=murG PE=3 SV=1
B7J3V2	2.97e-47	5	319	6	312	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) OX=243159 GN=murG PE=3 SV=1
B5ELC3	2.97e-47	5	319	6	312	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31) OX=380394 GN=murG PE=3 SV=1
B0K8K7	6.78e-46	3	357	2	364	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=murG PE=3 SV=1
B0K3H0	6.78e-46	3	357	2	364	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Thermoanaerobacter sp. (strain X514) OX=399726 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000480_00157.