CAZyme Information: MGYG000000480_00973

Basic Information

• Species: CAG-312 sp900546565
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900546565
• CAZyme ID: MGYG000000480_00973
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		47738.45	9.9248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000480	1940095	MAG	Fiji	Oceania

• Gene Location: Start: 24390; End: 25661 Strand: +

Full Sequence      

MIWLYRLFFLPAFAAMFPYYGLRMLRRGGYARDFSHRFGCMPKLPPKAAGKKRVWLQAVS
VGEVDAVMPLVRKLEKSGKYEVVITTTTSTAYALLKDKYKNDCFASAVFPLDFWLFNRRA
WNKINSDIAVLMEGEVWPEHLHAAKTRGVPAVLINARLSDRSFSRYAKVPFFARRMFEKF
AKICVSNESDARRFEKLGIDKNKLILTGNIKFDTPSAGVSEDEKLRLRRELGFGEKSFVL
LGSSTWKGEEKMLVGAMKTLRERGLDCRLLLVPRHAERRNEIKPEIAEFKNCVRTERKQA
EPDTIIYLADTTGELRMLTSIADLAYVGKSLFGHVGGQSPIDAAAAGVPVVYGQNMTNFK
LVCQKLEAAGAARRVFTPEEAVAQIAELAFDDGARKIMSQCAVEWHRQNEGATDKTIEVI
ETL

Enzyme Prediction     

No EC number prediction in MGYG000000480_00973.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	34	214	1.1e-56	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05749	PRK05749	4.53e-113	1	421	2	418	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
COG1519	KdtA	2.13e-98	1	421	1	416	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam04413	Glycos_transf_N	1.56e-61	37	213	3	175	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
cd03807	GT4_WbnK-like	1.21e-07	143	423	97	360	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd03801	GT4_PimA-like	3.52e-07	40	409	5	351	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY36206.1	6.29e-124	1	418	1	425
ACB75815.1	9.84e-122	1	420	1	420
ADE56009.1	9.61e-121	1	422	1	425
AHF93865.1	1.24e-120	1	417	1	425
SDR67662.1	4.25e-120	1	420	9	428

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BFC_A	9.84e-08	235	420	40	227	ChainA, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AC77	2.38e-52	18	421	15	417	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
P0AC75	2.38e-52	18	421	15	417	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1
P0AC76	2.38e-52	18	421	15	417	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
P44806	3.21e-42	21	421	22	420	3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=waaA PE=1 SV=1
Q45374	1.13e-36	23	421	24	424	3-deoxy-D-manno-octulosonic acid transferase OS=Bordetella pertussis OX=520 GN=waaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997370	0.002576	0.000056	0.000009	0.000007	0.000016

TMHMM  Annotations     

start	end
2	21