CAZyme Information: MGYG000000481_00153

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS1387
• CAZyme ID: MGYG000000481_00153
• CAZy Family: GH63
• CAZyme Description: Periplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521		60105.59	5.5891

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000481	2443498	MAG	Fiji	Oceania

• Gene Location: Start: 27409; End: 28974 Strand: -

Full Sequence      

MRSGIPRAELYSERTVNVREYYPINKDVSYIDNPYFKENTFHDVHTEELPEYEKIKHLLP
KPIWDGHETELECYDFAWKTAFGNIKNPSPESGFVSPFIDTAFNGDLFMWDSSFILMFCK
YALHIFNFQQTLDNFYAKQHRDGYICRQLNEKNGGDAYSRFDPASTGPNIMPWCEWEFFR
QSGDKGRLEKIFPCLLAYHEWLKENHTWRDGSYWSSGFGCGMDNINSRLPEGVNPKFSHG
HMVWVDTNMQQVLSGELLVKMAEILGSDGEKAVAEIAEESEYLKKYINNNLWDEKSAYYY
DLRRDGSLNYSKHIGAYWALISGVVPKERLCAFVSHLDNPDEFKRPHRVPTVSADDPFYC
ETGNYWNGSVWAPTNYMVLRGLEKYGYEELAYDIAVNHLGAVTEVYRDTKTVWENYAPEF
IEKGGSSKADFVGWTGLVPISVMMEYVLGIRAAAGENKLTWHINRTERHGVEHYPVGNGK
FADLVCDARKSADEKPCVHIKSQKNIEVGIFWNGKSEIIKA

Enzyme Prediction     

No EC number prediction in MGYG000000481_00153.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	102	436	1e-33	0.35789473684210527

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.60e-15	258	419	591	759	alpha-glucosidase; Provisional
COG3408	GDB1	7.56e-15	134	456	310	616	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	1.12e-14	257	446	310	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	5.01e-14	188	445	188	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	2.29e-07	241	416	350	517	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHT63246.1	3.07e-193	16	521	13	523
AIQ57834.1	6.23e-189	30	520	7	496
QIN83484.1	6.85e-181	29	520	10	508
ADV42089.1	2.60e-179	6	519	25	536
AVM57368.1	1.80e-177	20	519	28	525

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	8.57e-07	145	418	370	731	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	8.57e-07	145	418	370	731	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.49e-06	145	395	370	709	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	2.73e-06	245	418	100	280	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	2.73e-06	245	418	100	280	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	4.16e-30	112	504	62	444	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
O14255	1.14e-12	188	445	528	806	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
P42592	4.74e-06	145	418	393	754	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000481_00153.