CAZyme Information: MGYG000000481_00393

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS1387
• CAZyme ID: MGYG000000481_00393
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244		28085.53	8.4512

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000481	2443498	MAG	Fiji	Oceania

• Gene Location: Start: 3016; End: 3750 Strand: +

Full Sequence      

MSIPKVIHYCWFGGKELPSLAKKCIKSWEKYCPGYKIVRWDETNCGLDSCAYIKEAFEAK
KWAFVSDYIRLKAVYENGGIYLDTDVEIIKPLDTLTGLCGFMGFDEKGIVATGLGFGAEK
GNAVICEMMKDYENAHFLKSDGTYDLTPCPDRNTSTLQRLGMDTRNTSQTFMDMTFLPRD
YLCPMDYATGKIHITQNTYSIHRYCASWTSAAAKRTKFVKRIIGVRLYEKLYGKFLHKFK
WLEW

Enzyme Prediction     

No EC number prediction in MGYG000000481_00393.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	96	1.3e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	4.29e-16	3	95	82	177	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.78e-14	18	95	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.79e-10	3	93	46	141	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	6.74e-04	52	98	160	216	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31225.1	5.08e-83	3	224	2	225
AYV37964.1	2.88e-78	1	236	1	232
ACD37145.1	5.43e-78	3	238	2	237
QGH87046.1	5.43e-78	3	238	2	237
BAQ02241.1	5.43e-78	3	238	2	237

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000481_00393.