CAZyme Information: MGYG000000481_01150

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS1387
• CAZyme ID: MGYG000000481_01150
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662		75704.82	5.7786

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000481	2443498	MAG	Fiji	Oceania

• Gene Location: Start: 3307; End: 5295 Strand: +

Full Sequence      

MEIFNPKWITNKEFCDLEPENVFHKACVNSDYKPDESLANKHILFRKKFGAKKGGKFVMR
ITADDYYKLYINGKFVTQGPAPAYHFNYYYNTVDVTDFIADGENTVAVHTYYQGLINRVW
VSGDRRHGLALDLKNGENTVIATDESWKCHKHTGFSALGKFGYDTAFAECYDAGCAEKGF
EKCGFDDSYWENARINKYADYTLFPQPTKQLDIYDVKPQTVTKTDDGYIFDFGFEAVGYL
KFTASGKKGDCIDIYCGEELNEDGSVRWKMRCNCDYAEKFILSGNKDDILNQYDYKAFRY
AQIKIPDGVEFSPETVRFTVRHYPYVQKKVFASDSDSKMKAIAKLCADTLKYGVQECFMD
CPSREKGQYLGDVTISGLAHLHLTGDPSMILKAFDNYAQSSFVCKGLLAVSPCAYMQEIA
DYSLQFPMQVLEVYKYTKDKSVLEKYYPYVMNVLEYFGKYRRENGLIDRVDEKWNLVDWP
ANLRDNYDFPLKNPQDEPGFHNVINAFYCGMISDIDEICGILDIEPTGLKESTYKAFVNA
FYDPKQKLFVDSIGSKHPSLHSNILPLLYSIGINEENKDVIINHIVSKKLTSAGTYMSFF
ALYALKKAGRYDLALELIKDSGAWLNMINEGATTCYEAWGKDQKWNTSLFHPWSASPAII
LD

Enzyme Prediction     

No EC number prediction in MGYG000000481_01150.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	223	659	7.3e-81	0.8531746031746031
CBM67	38	195	1e-37	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.33e-19	335	658	9	333	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.06e-17	61	207	10	164	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.80e-12	222	322	1	100	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43798.1	3.05e-193	2	651	73	722
BBH20286.1	2.82e-188	8	661	9	667
QBE96895.1	3.73e-188	1	661	1	657
QCT01521.1	1.65e-187	2	661	3	666
QMW79864.1	2.11e-187	1	661	1	657

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.66e-19	217	661	425	872	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6GSZ_A	1.43e-18	17	639	106	742	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.66e-16	2	641	143	809	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
4XHC_A	1.22e-11	219	661	86	538	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	3.78e-24	216	658	595	1065	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000481_01150.