CAZyme Information: MGYG000000483_01540

Basic Information

• Species: HGM11416 sp900766495
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; HGM11416; HGM11416 sp900766495
• CAZyme ID: MGYG000000483_01540
• CAZy Family: GH94
• CAZyme Description: Cellobiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536		60871.61	5.452

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000483	1951388	MAG	Fiji	Oceania

• Gene Location: Start: 3129; End: 4739 Strand: -

Full Sequence      

MQFDLTVSEKPQNLSVFLGTYGQTESVEPLLEKLRKKDYAKKEFENVKNRLKIRKEFFSV
DIPDKDMQRMANVFNPLQAYVNFLVCREISFYATGTVRGVGMRDAAQDVLANILYDLPAS
EEKILLLLGQQYNCGKTNHYFYPVEKREPLISDRSDNHLWLVYAVYKVICESGKPDFLNK
TAPYFDGGDGTVLEHIEKSIEYTVNHLGEHGLPLMLGSDWNDMLSNVCKEGKGESVFVSQ
MLVLACKQLKEIYEITGKNNDKLNEIIEQQENVLNDYCWNEDRFIRAVSDEGLRIGNRDE
KCGALWINSQSWAVMSGCSDEEKLRKCMETTVSTLDCGYGLLKLYPPLQRNYPSKEHELT
FAQPGVNENGGVFCHANTWAIIAECMLGNNNEAYKIYKELIPHNIIKKFGVERYNAEPYI
YSSNIRAPIALDAGQAGVSWLSGTASWMMIALEEYIFGVKPCYKGLKIMPCIPDEWEKAV
IKRRFRGCEYTIEIDNSAACGNTVKEIYLDGKKYGGEYILSSAPTASVKVIMGTRN

Enzyme Prediction     

No EC number prediction in MGYG000000483_01540.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	3	519	8.1e-141	0.5

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17167	Glyco_hydro_36	8.02e-104	54	460	5	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
COG3459	COG3459	1.49e-102	2	534	517	1055	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98363.1	1.24e-152	3	496	244	740
QQZ61967.1	1.07e-151	12	530	301	820
CQR58309.1	4.24e-151	12	530	301	820
AIQ71088.1	1.68e-150	12	530	301	820
QSF44045.1	2.23e-150	1	530	262	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QDE_A	1.77e-81	30	533	287	811	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
2CQS_A	1.41e-70	58	530	342	838	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3AFJ_A	1.95e-70	58	530	342	838	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127]
3S4C_A	7.54e-70	58	530	322	818	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]
3ACT_A	1.37e-69	58	530	342	838	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127],3ACT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9K7M6	2.23e-88	45	533	296	813	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q76IQ9	1.01e-64	58	516	304	783	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
Q9F8X1	4.96e-58	2	533	251	800	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1
P20471	5.25e-48	4	520	2298	2831	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
Q7S0S2	5.68e-32	60	494	321	753	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000483_01540.