CAZyme Information: MGYG000000484_01647

Basic Information

• Species: Butyrivibrio_A sp000431815
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Butyrivibrio_A; Butyrivibrio_A sp000431815
• CAZyme ID: MGYG000000484_01647
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000000484_10|CGC1	36689.53	4.8993

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000484	2428908	MAG	Fiji	Oceania

• Gene Location: Start: 39377; End: 40345 Strand: +

Full Sequence      

MDKKKFSKRKVIIPAALCAAVIVTVAAVLFGADSYRNHIRKKVLSYEQETNEQGIAQYMD
DNPYFATKQPGFAYREPDVIKYYSGVTDSYRHATVILPDDYDDDKKYPVLYLLHGLGGSH
KTWINKDADVIIHNLNYFNNVPDMIVVLPNSEVNKEEDADNLPIEERIAIYDKTEEDLIN
YLMPYIEEKYPVKTGRDNTAIAGNSMGGRNTIYIAFKHQDIFGYAGAFSTAGVVKGESKK
TVMYPLLDDLVIDPEYGGFKLLMLEVGNEDNVCGWVTYDLDRMMTEKGIEHIFYDTNGGH
QTTVWQNALYNFCLRLFTNDNK

Enzyme Prediction     

No EC number prediction in MGYG000000484_01647.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	86	312	4.5e-43	0.9515418502202643

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	5.56e-15	58	317	52	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.52e-10	109	229	26	142	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	5.82e-09	176	229	118	169	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG0400	YpfH	4.12e-05	109	312	20	201	Predicted esterase [General function prediction only].
pfam02230	Abhydrolase_2	2.08e-04	109	229	16	137	Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL52399.1	1.18e-45	44	317	43	322
ADZ84563.1	2.83e-45	71	317	224	472
QEH70018.1	5.66e-44	71	317	224	472
QEH42336.1	1.29e-40	63	317	29	275
ACX65534.1	1.76e-40	78	317	22	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CXU_A	2.01e-36	65	317	14	270	Structureof the CE1 ferulic acid esterase AmCE1/Fae1A, from the anaerobic fungi Anaeromyces mucronatus in the absence of substrate [Anaeromyces mucronatus],5CXX_A Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_B Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_C Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus]
1JJF_A	1.64e-29	80	312	35	253	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	4.43e-29	80	312	35	253	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	1.38e-23	80	317	142	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZN_A	2.89e-21	82	317	137	385	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	5.72e-27	80	312	54	272	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	1.87e-15	80	317	434	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	1.73e-13	80	317	146	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	1.33e-09	66	244	483	670	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.794381	0.174100	0.012879	0.001938	0.001052	0.015657

TMHMM  Annotations     

start	end
12	34