CAZyme Information: MGYG000000485_01274

Basic Information

• Species: Zag1 sp900767135
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp900767135
• CAZyme ID: MGYG000000485_01274
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
661		76386.05	8.9321

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000485	1980530	MAG	Fiji	Oceania

• Gene Location: Start: 26029; End: 28014 Strand: +

Full Sequence      

MFDWDMKKKIALTITAVLILGGTCFAMFYQSPAKTDEIYKSALEDFSKGDYQNAYYLFSK
ISFFSNLKPIAIYHRGECARLLGDDKSEIKQYQFLFNNYPHNKLSIRARYLAGQKLVETN
PKTAKKYFENIIHNAPDTDYAIASEYYLGVILQNKYQSAKIIPKSAIDDVQNYYRHYLTK
APSGRLALKAVEHWLDFADDISQDDYLLMANSCYQLGEYAKTREILQKTNLNENWALDVK
NSYAMKNYPRAKFLTENGVQKRSQYVTDDEIIEAIDIYVKLSDSKTKAVERLLGLSSGKG
RDYLMDLKCQNSSQNEKVACYSNLYLKYPDGKFSADALANIFFAKIKSGDLTNARKIGMD
HLKKFPDTNSSPMVMFWLGKIAEKNNNYSEYTSYYKSVINKYPDSYYAYRSYLKLSGMQG
PLITGTIYPQPVVYPYKYTRNNIIVKLVDLKDFDVVNEMCPDDDFVKSWVLYQKGDYSHS
MLVARDAMEKIKNKPDKYDLRWRLIYPVIYYDDVVKYSGQTGNNAPLMLSLIREESYFDP
LAQSVVGASGLMQLMPSTAGEINAKMGLGMNVSSALFNPHQNIKLGNYYYLFLRRNLEGY
DISSVAAYNGGIGSIQKWKSSLHYNDTDEFVEQIPYAETQNYVKKVFRTYWNYIRIYDRN
Y

Enzyme Prediction     

No EC number prediction in MGYG000000485_01274.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	520	652	6.8e-24	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	9.18e-51	506	653	2	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	1.47e-37	507	650	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	6.03e-28	527	651	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.92e-27	506	660	135	290	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	1.38e-23	512	646	1	157	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39013.1	0.0	1	660	1	660
AKV69146.1	1.82e-46	67	658	118	708
QHU83802.1	4.57e-46	67	658	118	708
AVQ70459.1	6.21e-46	67	658	118	708
ARI81489.1	8.44e-46	67	658	118	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.18e-18	500	646	406	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.19e-18	500	646	410	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.21e-18	500	646	416	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.23e-18	500	646	420	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.25e-18	500	646	426	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	2.69e-15	506	653	476	627	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.69e-15	506	653	476	627	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	4.34e-14	506	646	476	618	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	1.49e-11	514	651	64	180	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P44888	1.81e-11	529	646	447	565	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.948359	0.044170	0.002130	0.000476	0.000240	0.004633

TMHMM  Annotations     

start	end
12	29