CAZyme Information: MGYG000000485_01551

Basic Information

• Species: Zag1 sp900767135
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp900767135
• CAZyme ID: MGYG000000485_01551
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		42324.46	9.3052

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000485	1980530	MAG	Fiji	Oceania

• Gene Location: Start: 8890; End: 10008 Strand: -

Full Sequence      

MKKVFIITGEYSGDIHASHVVKALKQINPDVEIEGVGGENLKNAGVKLFSDQKKMGAVGL
SLKIITDHFLLGKRIVDYLTKEYRPDLVLLIDYGVFNLNISKFLKRAGIKTLYYIPPQVW
ASRKWRINTIKKNIDEVLCIFPFEKTMYESYGIKTHYCGHPLVSQLPEKANRDKFFEKHG
LDKNKKLVAIFPGSREFELKFLMKVFVKTAQNLQKQHPDLQFCISHAPNLSDSVYDKYLQ
KTDFPVIKGENQALLSVSDALILASGTVALEACLYQTPMIIAYRGPWLFYLIYLVVRCIK
RVSLPNIIADKSIVPEIIQGDVNVSKISYEIEKLLYDNDYRQQNIEDLGDVKALLSDKIS
SVEVAKVINNSL

Enzyme Prediction     

No EC number prediction in MGYG000000485_01551.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	354	3.1e-108	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	7.83e-120	1	371	1	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	9.77e-106	1	369	1	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.15e-78	4	336	1	337	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.48e-70	4	359	8	369	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.85e-45	1	371	1	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	1.56e-229	1	372	1	372
AKQ33376.1	8.32e-77	2	367	6	371
CEK10842.1	3.82e-76	2	372	5	379
ASQ45794.1	2.08e-75	2	372	5	380
VEH12442.1	9.50e-75	2	372	5	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	5.67e-49	4	335	9	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.11e-48	4	335	9	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ZVR9	1.05e-70	3	356	6	363	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpxB1 PE=3 SV=1
B6J161	1.67e-70	2	370	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	2.36e-70	2	370	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
Q83DS5	2.36e-70	2	370	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	2.36e-70	2	370	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000485_01551.