CAZyme Information: MGYG000000486_00663

Basic Information

• Species: Phascolarctobacterium_A sp900770955
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900770955
• CAZyme ID: MGYG000000486_00663
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
519	MGYG000000486_4|CGC1	59041.98	8.3921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000486	2258701	MAG	Fiji	Oceania

• Gene Location: Start: 14537; End: 16096 Strand: +

Full Sequence      

MNQIEKNSLLIVAGTALFMIMFGIGSIPLLDPDEPVYAETAREMLAAGDFLSPRIFGDFW
YDKPPMYYWLVSAAQFIFGDNEFAARFPAALMACGTSVMMYIGITGLFNERAGFWSAMIL
TSCVEFFYMGKAAVTDTTLLFFMTGALLSFIHKRYWLMYVCMALATVTKGPIGIVFPGAI
IFLYLVAMGQLREIFRMHVIRGLLLYFLIASPWYYAMYTVHGMEFINTFLGFHNITRFTT
AEHANRVTFWYYFPVIILGLFPWTGMLWQAAKASVSESRIDDMRKLLFFHVWWIFVLLFF
TICKTKLVSYILPLFPAMAVIIGWNIARMQSRLRHNTTFYGWATGSGIMFVLLGVGWIIG
AQYLPEADFSLVMLGVLTLLLGAAVIFALLYYRDIELASWLHVMIGAVTMCVAFAFVLPV
VADRFSVKTMSSVYKEQCEQQTPVYVDKFLRPGFMYYAGKPGIEMIPQTSALSDALRDGS
KKYILVRGLEYRRVQKAGPLPDNVRTVKEISDIYLLEQN

Enzyme Prediction     

No EC number prediction in MGYG000000486_00663.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	482	5.7e-115	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	6.50e-59	16	401	17	411	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	5.97e-38	16	334	12	341	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	3.01e-14	62	215	1	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	3.21e-09	37	226	35	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV77242.1	0.0	1	519	1	519
AOH48432.1	1.07e-168	18	496	21	504
QNH53437.1	9.87e-167	10	494	13	502
ANR70824.1	1.60e-165	10	496	13	504
AME03144.1	6.24e-160	10	493	13	501

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.50e-35	29	332	54	370	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	3.01e-38	10	321	6	316	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
O67601	1.88e-37	6	353	2	327	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
A0KGY4	6.19e-36	17	325	13	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A4SQX1	1.19e-33	28	323	24	327	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
C6DAW3	1.11e-32	29	372	30	387	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000019	0.000009	0.000001	0.000000	0.000000	0.000005

TMHMM  Annotations     

start	end
7	29
86	108
113	135
155	186
199	221
248	265
286	303
307	326
339	361
371	393
400	422