CAZyme Information: MGYG000000486_01145

Basic Information

• Species: Phascolarctobacterium_A sp900770955
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900770955
• CAZyme ID: MGYG000000486_01145
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		35744.9	4.5314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000486	2258701	MAG	Fiji	Oceania

• Gene Location: Start: 33639; End: 34637 Strand: -

Full Sequence      

MRCLPTAFCHASTVLALPDGSLLCCWFGGTHEGESDVGIYLSRRTDAGWSEPKLLVNGAA
ANWNPVLFAGADGRLLLFYKQGQQIADWQTWLLQSTDNGETWSGPQELVPGDVSGGRGPV
RNKPLRLASGRILAGASTEHGIWKAFADISDDDGASWHKSSAVQIEGLQYQAGEKTADSN
IAVSQQSFYGRGVIQPSLWQSADGSVHMLLRSSEGFVYRSDSADDGATWCSAYALSLPNN
NSGLDLVRTAGGVLYLVCNPVAANWGQRSPLSLFQSTDDGASWQKLLDLETEPAEFSYPA
IIADGEGLVLTYTYKRCNIACVRLSADELVTL

Enzyme Prediction     

No EC number prediction in MGYG000000486_01145.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	9	305	1.3e-28	0.8713450292397661

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	3.21e-89	20	309	1	278	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4692	COG4692	9.30e-61	9	324	33	371	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd15482	Sialidase_non-viral	1.00e-48	5	316	10	326	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
smart00602	VPS10	6.47e-04	208	327	3	107	VPS10 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV77693.1	2.85e-247	1	332	7	338
ALS21221.1	1.59e-118	5	327	16	338
AUS95056.1	2.80e-118	9	327	20	334
AZS14954.1	8.45e-106	7	320	18	330
AFH63259.1	4.08e-102	5	320	21	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YA4_A	3.78e-06	91	229	238	382	Crystalstructure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA4_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA5_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA5_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA6_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA6_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA7_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_C Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_D Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA8_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4],2YA8_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4]
5KKY_A	3.79e-06	91	229	241	385	Structureof Streptococcus pneumonia NanA bound with inhibitor 9N3Neu5Ac2en [Streptococcus pneumoniae],5KKY_B Structure of Streptococcus pneumonia NanA bound with inhibitor 9N3Neu5Ac2en [Streptococcus pneumoniae]
6QZH_A	4.49e-06	91	229	426	570	Structureof the human CC Chemokine Receptor 7 in complex with the intracellular allosteric antagonist Cmp2105 and the insertion protein Sialidase NanA [Homo sapiens]
2W20_A	4.90e-06	91	229	217	361	Structureof the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6],2W20_B Structure of the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6]
3H72_A	4.93e-06	91	229	221	365	Crystalstructure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H72_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H73_A Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6],3H73_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.932272	0.067278	0.000241	0.000084	0.000047	0.000094

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000486_01145.