CAZyme Information: MGYG000000486_02056

Basic Information

• Species: Phascolarctobacterium_A sp900770955
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900770955
• CAZyme ID: MGYG000000486_02056
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209		24723.49	9.4794

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000486	2258701	MAG	Fiji	Oceania

• Gene Location: Start: 11269; End: 11898 Strand: +

Full Sequence      

MAPVKVNRKARSRRRKKSGRLHSWLLMLGVLLAVCFGCWKVWSSDTVQMRFVYMWDYQQD
IVTYSKKNDVDPFLVAAIIKNESNFKHDAVSKVGAVGLMQIMPETGRWIAEQMGLKNYQD
SDLYQTRTNIRMGCWYVGELEHEFQHNLVLLMVAYNAGRGQTHEWMQENGWDYNFNDIKS
IPYPDTREYVAKVLQDRDKYYLLYKDKIK

Enzyme Prediction     

No EC number prediction in MGYG000000486_02056.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	69	198	1.3e-26	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.43e-76	55	199	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.29e-52	57	205	6	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.59e-36	72	195	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	4.12e-31	56	209	138	292	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.21e-26	64	171	4	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV76946.1	2.53e-141	4	209	1	206
BBG64618.1	1.07e-95	13	209	4	199
QNP77119.1	1.72e-92	24	209	26	210
ADB46849.1	4.91e-70	11	209	3	197
AEQ23289.1	2.25e-63	11	204	2	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.79e-24	53	204	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.82e-24	53	204	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.86e-24	53	204	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.88e-24	53	204	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.91e-24	53	204	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	8.70e-16	22	201	454	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	3.29e-14	77	207	448	578	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P0AGC4	6.20e-14	40	201	467	625	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	6.20e-14	40	201	467	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
O31976	8.41e-13	53	199	1418	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998598	0.000674	0.000496	0.000003	0.000002	0.000244

TMHMM  Annotations     

start	end
21	43