CAZyme Information: MGYG000000487_01801

Basic Information

• Species: CAG-115 sp900768125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp900768125
• CAZyme ID: MGYG000000487_01801
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		44414.2	4.908

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000487	2815466	MAG	Fiji	Oceania

• Gene Location: Start: 28201; End: 29340 Strand: -

Full Sequence      

MTEYRTDIEALKKSLSAKHVDPGKLITEDPTPNTLRLWEFLKSCYGKKFISGQQYLWEDE
KEDLVYYRTTGKIPAIRGYDFMGISGLARGYDQLGRAIDWARRTGGILTMCWHWNAPDDM
NDIGGLSSFYYKTTNYDRKTGFDIVRAMQEGTPEHDFIIYEIDLVGSALKMFEQQDIPVI
WRPLHEAAGNWFWWGNRAPAGQQDAESIEAYKKLWYTIFDRLMNYHKLRNLIWVWNGQAP
FMAVDPNTYDIAGEDIYDEVPNHGSQLERFRAVSSYTHGKMITLSECGSIPDPDEMQKDG
ANWLWWLPWWGTFVYDTDGEWKTILDEDGMPRPNPKYMDEAFMKRVFSDPRVITLEDLPW
YDREAKPLPYALHHWLNKC

Enzyme Prediction     

No EC number prediction in MGYG000000487_01801.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	28	356	2.8e-82	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.15e-38	26	311	1	284	Glycosyl hydrolase family 26.
COG4124	ManB2	5.55e-08	112	261	138	260	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL34792.1	1.50e-158	23	372	9	352
CBK96404.1	3.02e-158	23	372	9	352
CBK96003.1	9.18e-104	3	375	69	438
CBL34396.1	2.60e-103	3	375	69	438
ACX63523.1	2.25e-77	12	359	3	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	1.47e-52	24	364	44	362	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6HPF_A	1.21e-49	71	358	49	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	3.55e-46	33	358	153	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	2.28e-45	26	359	35	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	2.43e-28	19	309	20	299	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2R6F5	4.04e-50	26	355	29	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P49425	3.95e-49	22	359	143	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	7.87e-48	37	362	186	481	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	2.08e-47	37	358	41	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55298	4.57e-46	19	334	151	463	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000487_01801.