CAZyme Information: MGYG000000488_00648

Basic Information

• Species: Anaeroplasma sp900767915
• Lineage: Bacteria; Firmicutes; Bacilli; Acholeplasmatales; Anaeroplasmataceae; Anaeroplasma; Anaeroplasma sp900767915
• CAZyme ID: MGYG000000488_00648
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	MGYG000000488_8|CGC1	92840.09	6.6365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000488	1945837	MAG	Fiji	Oceania

• Gene Location: Start: 38877; End: 41339 Strand: -

Full Sequence      

MKYKEIIDKLTIRQKCDLLTGKDFFITLEINELGIPSACLSDGPHGLRKQVSASDHLGLN
ESVPSTCFPTAVTIANSFNPKLGEEIGVALAEEAISMDVNMILGPGTNIKRNPLCGRNFE
YFSEDPYLAGKMASSYIKGIQSKGIRGCVKHFAGNNQEFRRMTVNSDIDERALREIYLMP
FEMAVKEGHAKGIMSSYNRLNGQYANESMHLLRDILRNEWGFDGVVVSDWGGCNDRVAGV
IAGSDLEMPACKYGADDIYKALTKGWDNPYKRDEDPKNYDEIEKGIVDGKLNIELVDECC
DRVLDFVFETDKNIKENKKDFDKTLHHNLAYKAALESIVLLKNDNGALPLGNDKVCFIGD
FCKNPRYQGAGSSVVNPIKLDNVYDEIKNYDINFIGYEKGFDRYGKNKNGLLKKALELAK
KSDRIVYFMGLDEVTEAEGLDRTTINIPNNQLILLKELQKLNKKVIVVLSAGSITNMKIV
NDSDAILHGYLSGEAGACAILDILSGKENPCGKLSESFPFNYEDNSSSKYFPNRLSVRYK
ESIYVGYRYYDTKGINVCYPFGYGLSYTKFKYSNLKVDKDKVSFDITNIGNVKGKEIAEL
YIGKKDSNVFRADKELKGFNKVELEPNETKNVSIMFDEYSFRVFNPKDNKFEIENGKYQI
YVGSSSRDILLSDEIEIEGIDVDFGYSKEVMEKYGNCDINDISDELFEKLLGRKLITDEY
VFYKKNRMIIHENATVEDLRYSRGFAGRLFSFVIRFLTKFLWLVGAKTTSNTLVMGVLHQ
PVRGLAKFGGFNRTKMEGLLMMFNGHFFKGLHYFLKKEKI

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	249	1.6e-69	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.29e-71	28	365	53	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	2.95e-71	66	669	118	757	beta-glucosidase BglX.
PLN03080	PLN03080	4.09e-55	30	637	76	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	4.22e-50	338	567	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	5.51e-42	29	304	60	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEU80235.1	1.20e-304	1	820	1	801
AOZ92946.1	1.75e-295	1	818	1	795
AZK48658.1	6.45e-286	1	818	1	796
AYV69402.1	1.21e-285	1	818	1	795
AYV72214.1	1.71e-285	1	818	1	795

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	4.30e-193	4	677	6	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.79e-158	7	679	9	665	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.11e-123	2	677	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	3.18e-122	2	677	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.58e-99	4	678	7	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	2.36e-192	4	677	6	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	2.14e-155	3	679	6	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	4.67e-154	3	679	6	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	1.89e-125	1	669	44	737	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	3.46e-109	4	678	12	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000488_00648.