CAZyme Information: MGYG000000488_00676

Basic Information

• Species: Anaeroplasma sp900767915
• Lineage: Bacteria; Firmicutes; Bacilli; Acholeplasmatales; Anaeroplasmataceae; Anaeroplasma; Anaeroplasma sp900767915
• CAZyme ID: MGYG000000488_00676
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1207	MGYG000000488_9|CGC1	131772.48	5.2745

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000488	1945837	MAG	Fiji	Oceania

• Gene Location: Start: 3474; End: 7097 Strand: -

Full Sequence      

MKLKKLGLIAFVSISLLALSSCKIDTSESKKANNQNTGSSTAFVTSTNKGTTTNKTSNPT
STPTSNPTISPTSTSTGNPTISPTSTSKVTPTNPTDAPNDSILPTGGGKVETETTVKFLS
VLGEYESAYVEFKCVEDATAYNFYLTGGKYKSTTKVDSSIVYYRLVNGVIRADFLGLEAG
EYTVEVKPVINNIEDENTGSTAKFTVVAYDRSGYAHFKYNEGVGAYNSDGTLKNNAIVLY
VTDDNKNTVTLTYGGKTVSGIGNILNSVGQGTTDLGHEGQCKKVVEGKSYYAKANTNQGI
LKDLAVANVPLVIRFVGCVSDSGLYKQGSFDASSKSLIEGLTSYANNNTVNEDGKKTSEN
NKLADYGGTLGDNGHMARMKSAKNLTLEGIGDDAIIDGWGFHLICEADFPNLAKNFEVRN
LTFMNTPEDAIGMEGQQESSTKTITASVERCWIHHNSFLAPNIQNPAESDKAEGDGSCDF
KRGQYFTCSYNYFEGCHKTNLVGSSDSSLQFNLSYHHNLWYNCGSRIPLLRQANVHFYNN
YILGGDNASYVSDIRANGYLFLEANYYQGAKNVIDGVESGSQVKMYNNELLATYSKFDIN
SVITNDRELKVTCSTAYKNISYQNFDTNPELFYYDSVNKRSDCYLTSPTVARNVCLAQSG
SKYRTNAKKTQITSDYQISNVKVENVVDFSNPFNVVWPTNKNDGFYGGIYYTNLTGLTSS
SVKFKGPGMTFKLNTIALLAITMTSSSGGYADGYVIDNVTGEIMLTGSGACVLKPGVYTV
VSTIYVEGTGKNTKETTVSSFSLTKYNSEELNKELLNDYNNAVKNLPSNIIYTEDVLALI
KSAITAYNSLPAEIKEQIETPYSVVEEKYNQYIALGKSYVEGLINDIGTVNSESGTKINL
ARIEYNKLLGLDSSVVITNYDVLAKALEAFKAYAVDSCIKAINNIGDVTLESKSLIDIAR
NAYNQLDDNEKALVTNYNTLVSKEEAYNNLVLVNNVITLINKGANTLEEYNTIYTEYNKL
SDLLKSQVTNKAKYYELMTNYTNLLISSLPEASNITISYKETISLAKELYNSLLDKTGIT
NYQKLLDCDSKLTELLGKRQILTFNTGASGDNSFFTVSGNLKSKPTKVIYDGVEYTTALK
MESSTSITFKSNSKCKITLVLSMAGNIKIDGKTYTSDNNGVVIVELEAGEHTITKGASLN
LYAIIVE

Enzyme Prediction     

No EC number prediction in MGYG000000488_00676.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	372	568	1.2e-41	0.8564356435643564
CBM77	1109	1202	2.6e-24	0.912621359223301

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18283	CBM77	4.22e-27	1100	1204	3	108	Carbohydrate binding module 77. This domain is the non-catalytic carbohydrate binding module 77 (CBM77) present in Ruminococcus flavefaciens. CBMs fulfil a critical targeting function in plant cell wall depolymerisation. In CBM77, a cluster of conserved basic residues (Lys1092, Lys1107 and Lys1162) confer calcium-independent recognition of homogalacturonan.
COG3866	PelB	3.03e-23	384	572	102	278	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	2.56e-19	382	568	15	187	Amb_all domain.
pfam00544	Pec_lyase_C	1.25e-11	450	567	89	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
pfam04886	PT	3.41e-05	59	98	2	34	PT repeat. This short repeat is composed on the tetrapeptide XPTX. This repeat is found in a variety of proteins, however it is not clear if these repeats are homologous to each other. The alignment represents nine copies of this repeat.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR71161.1	1.61e-162	114	660	38	558
CDR31241.1	4.79e-120	123	1195	326	1283
BBF42492.1	1.12e-112	123	799	42	671
ADU23076.1	2.25e-107	117	638	757	1216
QEH68115.1	8.82e-57	125	660	44	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	6.95e-20	375	567	71	246	Crystalstructure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
5FU5_A	6.99e-15	1106	1202	13	109	Thecomplexity of the Ruminococcus flavefaciens cellulosome reflects an expansion in glycan recognition [Ruminococcus flavefaciens]
1AIR_A	1.33e-12	452	588	142	282	ChainA, PECTATE LYASE C [Dickeya chrysanthemi],1O88_A Chain A, Pectate Lyase C [Dickeya chrysanthemi],1O8D_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8E_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8F_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8G_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8H_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8I_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8J_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8K_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8L_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8M_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1PLU_A Chain A, Protein (pectate Lyase C) [Dickeya chrysanthemi],2PEC_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi]
2EWE_A	3.16e-12	452	588	142	282	ChainA, Pectate lyase C [Dickeya chrysanthemi]
1VBL_A	8.37e-12	383	567	132	330	Structureof the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C1C1	4.76e-15	413	574	131	285	Pectate lyase 2 OS=Pectobacterium carotovorum OX=554 GN=pel2 PE=3 SV=1
Q6CZT3	4.76e-15	418	599	136	315	Pectate lyase 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=pel2 PE=1 SV=1
P0C1C2	8.50e-15	413	599	131	315	Pectate lyase 3 OS=Pectobacterium carotovorum OX=554 GN=pel3 PE=1 SV=1
P0C1C0	8.50e-15	413	574	131	285	Pectate lyase 1 OS=Pectobacterium carotovorum OX=554 GN=pel1 PE=1 SV=1
Q6CZT2	8.50e-15	418	599	136	315	Pectate lyase 3 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=pel3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000028	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000488_00676.