CAZyme Information: MGYG000000489_00047

Basic Information

• Species: Agathobacter sp900548765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900548765
• CAZyme ID: MGYG000000489_00047
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1368	MGYG000000489_1|CGC1	145877.44	3.8957

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000489	2786257	MAG	Fiji	Oceania

• Gene Location: Start: 52202; End: 56308 Strand: -

Full Sequence      

MKKKTIVRITSMAMAAMLTVSQLGLGDGIRVFAEETAEGEASDSSTVTAESVTLQDSDFT
GSLWEDGIWTVNPTTWDDATFEYYTYATDQWLTPGEDAGETGFHFWMKSAGSFDLTQLID
VLPAGEYTLTSYVMGENADVDLTLEGADGNITVTTDGAVALDGYNSWHTVTETFEVKEDD
ADVAVGFNVAVADGGYGYLDHLTISGVSAEDAEPAAPTYTEVAATDYEFGTTNLLTNGDF
ETGDATGWTIEQDVDVTYEVQTNQWMTSNTTNFCNMYNGGSDAESISLSQGLNLEAGTYL
VSLDMDGKENVSSGLTLSVVGSGAEAGLEKELAKTTGFNTWSTETLAFTLSAADTATIKI
SGSMPADYWGDVDNIKLVKLASEESKDDTDNGSDDGDDADDTDDSTAVAANISVKKISGL
SDDFITGADVSSFLSLINSGAKFYDADGNELTNQGFFDLLASGGTNYIRLRVWNDPYDAD
GNGYGGGNNDLEAAKVMGQYATKAGMKVLIDFHFSDFWADPAKQQAPKAWSDMTHDERLE
AISTYTTESLKYLLDNGVDVGMVQIGNETTNGFCGETYKSNGWDKVSELFNSGCKAVRSV
SAEYNKDIQIALHFTNPERGNYPSIAKNLNTYGVDYDVFASSYYPYWHGTLSNLTSTLKT
VADTYGKKVMVAETSWATTLEDGDGHDNTVRVGNNDDNTSKEQLRYDFSVQGQANEIAAV
AQAVKNVGDSGIGLFYWEAAWIPVQYAYDEDGNVLSDVVESNKAAWEANGSGWASSYAGE
YDADDAGKWYGGSAVDNQSWFGFDGKALDTVNIYKYIRTGTKAPKLVTSVTADDITATIS
TVNGITLPATVDVKYNDGTSESAPVVWNSEDVKTAKESGVGSYTVNGKYTITSDSGVEVE
NDITIIVTVGYDNLLTNPGFESGLDGWEVSSAIINTKDAASNQRNGDGCAHFYTDKAGAS
ATATQTVKLKAGKYALTGYIQGGGNGTSDVFSIKAIVGDETYTAAGELSGWKVWSNPTID
EIVVTEDDTEIQVVLSIENTTAGVWGSFDDIALYRIGDIDSKDNTDTKDDADKGDSGNTD
TKEDTDKGDSGNTDTKEDTDKGDSGNTDTKDDADKENSGDTDSKDNGTPDLNNNGVSEDK
NESYITEEVDKSFASFGDTVDFANGGDRTVINNGISIKGSTSALPAGVKFEVSSLAKTSK
SYASAEKALSEKKLDGKFTVHEINLKDADGTQLHQMGDYVVVTLPVPEGFTVSSTTTIAV
YRLEDDGTLTKCTSTVVDGKLSFSADHFSTYVFVEEPVAAQVEPEQKPDPAEADTPSTAP
TASAAPVQTALASVKTGDDTGMGWMIMLLLAGLSAAVASAYGMKKTNK

Enzyme Prediction     

EC	3.2.1.89

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	425	812	4.3e-117	0.9912280701754386
CBM61	913	1053	3.6e-26	0.9858156028368794

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3867	GanB	2.91e-132	408	825	23	402	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	3.26e-117	425	814	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
pfam07532	Big_4	8.29e-07	833	888	2	55	Bacterial Ig-like domain (group 4). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in a variety of bacterial surface proteins.
NF000535	MSCRAMM_SdrC	2.91e-06	1058	1169	797	908	MSCRAMM family adhesin SdrC. Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.
NF000535	MSCRAMM_SdrC	1.05e-05	1058	1159	791	892	MSCRAMM family adhesin SdrC. Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK73963.1	1.04e-231	232	1070	43	860
QNM03783.1	7.95e-211	1	1058	1	1084
ADL34775.1	3.80e-203	243	1055	79	874
ADZ82428.1	3.07e-198	62	1064	45	982
QEH68121.1	3.24e-197	62	1064	45	982

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R8L_A	3.60e-145	405	821	5	395	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	2.68e-144	405	821	5	395	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
7OSK_A	6.41e-75	412	817	38	394	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1HJQ_A	2.86e-36	427	742	6	301	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1HJS_A	9.66e-36	427	742	6	301	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65CX5	4.66e-144	405	821	30	420	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
O07013	3.07e-142	409	820	38	423	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
P48843	1.00e-51	424	743	6	314	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
P48841	4.19e-40	418	742	19	330	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
Q9Y7F8	7.70e-40	427	742	22	318	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000403	0.998720	0.000266	0.000238	0.000179	0.000151

TMHMM  Annotations     

start	end
1340	1362