CAZyme Information: MGYG000000489_00089

Basic Information

• Species: Agathobacter sp900548765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900548765
• CAZyme ID: MGYG000000489_00089
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
622		71211.93	4.8959

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000489	2786257	MAG	Fiji	Oceania

• Gene Location: Start: 101696; End: 103564 Strand: -

Full Sequence      

MKITFYNLQKGIRYLRNYGLREFFIRISEKGEPENISYSDWYNKHKAAENELKKQKRESE
HWEDKPSFMVFIQCGGGINIDAQAVKRSIYSVLEQSYGQWSICVLNARKSMSDELSSFIK
AKAEHEILCTRADDILQDIEQTASGKWSYAAFLEAGHILSPDALYQAANAIENPASIRQS
GVHWDDDKSTIPDMIYTDEDMIQWSGDESDTDPFHYAPEFKPDFNLDLLRANNYMKHFLV
VSREIFIKAVTAETEPDVDKCFDFVFKCAENANRIVHIPRVLYSSVKGDDNDCINADTEI
KAIVNHLNRAGIKAEVHRTDYEGYYRIRYTNDEKPLVSILIPNKDERDSLDKCLKSIAAG
TYDNIEIIIIENNSTEPETFEYYKSLPERYDGKFEGGIKVVSWESNGLFNYSAINNYGRA
NAKGEYLVLLNNDIEIISRDWIEKMLSVCTRKDAGIVGAKLYYPDDTIQHAGIVAAIGGH
ARGVASNMLVGLDRYGDGGYMHKASVMQDYSAVTAACLMIKASVYDQIGGFEERLTVAFN
DVDLCLKARKAGYLVVYDPYVEAYHYESKSRGQEDTEEKVRRFQDEIEYMRSKWNDIMRY
GDPYYNPNLSRIKNDYSLNGMD

Enzyme Prediction     

No EC number prediction in MGYG000000489_00089.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	338	467	1.1e-17	0.711764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	7.22e-33	85	283	17	198	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.56e-28	339	567	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.12e-23	335	573	3	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd02525	Succinoglycan_BP_ExoA	3.17e-11	336	566	1	208	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
COG1215	BcsA	1.59e-08	328	564	47	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN97496.1	2.04e-181	1	618	14	644
CBL08069.1	8.22e-175	2	618	7	642
CBL12630.1	1.06e-172	2	618	7	642
VCV23340.1	1.55e-172	2	618	19	654
QQQ92271.1	2.56e-169	2	618	14	604

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.26e-82	79	618	376	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.84e-58	85	618	335	840	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P71057	2.04e-07	333	446	2	105	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
A0A0H2UR96	8.97e-07	336	467	4	126	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P9WMY2	1.24e-06	513	574	183	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000489_00089.