CAZyme Information: MGYG000000489_00125

Basic Information

• Species: Agathobacter sp900548765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900548765
• CAZyme ID: MGYG000000489_00125
• CAZy Family: GT27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1054	MGYG000000489_1|CGC2	122011.56	5.1649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000489	2786257	MAG	Fiji	Oceania

• Gene Location: Start: 152157; End: 155321 Strand: -

Full Sequence      

MENILFVKYNSTRKPEYRIKTEIVTYGVDRYVRKIALGSEANSHVSCLADYAKQINDVYI
NFAVAVPNIKNGDTAEYPFIEGKSEEERLKNLLDDKQAILNGLQAFIRCITELEADKYVV
FDISNEFLEVFGDDSSYTQLKGLEATKVANIDMIPENFIRNGNRLFCLDCEWVFLFPIPL
EFIKYRSLYYFYRKFAKNINELMTVDEYWNSFGLSKNKIEIYSLMEQKFQNYINGENSCC
RYTDRYVKQAIDFNTLVYRTHQFDVHCKRIEQLQQENTSRNEHISKLDKFIEEKDLYISD
KEAEILEKNNIITSLQTQLDNADERLRGCEYELEQSKELIIDKDVHIRNIEAKLNTDVLT
LNHEINLKNNHIANLEYGYNKWIKLCNNPIVKVVRFPKWFAKKAYHKLKDGDSIERLSVP
QFAKPKVTIIIPVYNQFDYTHACIKSIIDTVKDVSYEIVIGDDMSTDATRKIKKYISGIR
VNINKTDHGFLMNCNRAAKLAKGEFIIFLNNDTQVHEEWLSSLVTLIESDDKIGMVGSKL
VYPDGSLQEAGGIIWSDASGWNYGRNQDADMPEYNYVRECDYISGASIMISKSLWNEIGG
FDERFKPAYCEDSDLAFEVRKRGYKVMYQPKSVVTHFEGVSNGTDLDSGLKKYQVENSKK
FKEKWAAELAKQYESGQVPFCARERNHGKKVILIIDHYVPTYDKDAGSKTTFQYIKMFIE
KGYVVKFVGDNYAKMEPYLTTLEQLGVEVLYGPWYAQHIFEWIDANKDYISIAYLNRPHI
TEKYIDYIRENTNIKIIYYGHDLHFLRTQREYEIEKDENKLAESKMWKAKEFDILKKSDM
NYYPSYVEKEAIHKIDASIPVKAITAYVFEQFIQDYKYDAAERKGILFVGGFSHGPNVDA
VKWFAEDIYPLIREKNEDIDFYIVGSNAPDEIKQLDGNGIIFKGFVSDEELMELYSKCRI
VVVPLRYGAGVKGKVVEAIYNGAPIVTTSVGAEGIAGVENVLKIADDAEAFADTVVDLYS
DYEALTSLANKTQSFIKENFSIDAVWNIVREDFE

Enzyme Prediction     

No EC number prediction in MGYG000000489_00125.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT27	429	673	5.7e-25	0.8677966101694915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	4.95e-44	429	638	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.67e-38	425	648	3	231	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam13692	Glyco_trans_1_4	1.34e-31	883	1021	1	138	Glycosyl transferases group 1.
cd02525	Succinoglycan_BP_ExoA	1.63e-24	426	637	1	208	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd03801	GT4_PimA-like	7.59e-23	692	1045	2	357	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX92521.1	0.0	2	1053	264	1314
ASN93838.1	0.0	2	1053	264	1313
QRP41495.1	0.0	2	1053	264	1313
ANU46567.1	0.0	2	1053	264	1314
QJU21849.1	0.0	2	1053	264	1313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S22_A	9.35e-07	425	636	183	413	Crystalstructure of the TgGalNAc-T3 in complex with UDP, manganese and FGF23c [Taeniopygia guttata],6S24_A Crystal structure of the TgGalNAc-T3 in complex with UDP, manganese and the peptide 3 [Taeniopygia guttata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	2.36e-17	406	645	546	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P55465	1.17e-15	420	643	620	852	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q48455	8.10e-15	876	1049	201	384	Uncharacterized 44.6 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
Q7K755	2.73e-08	407	636	140	388	Putative polypeptide N-acetylgalactosaminyltransferase 11 OS=Caenorhabditis elegans OX=6239 GN=gly-11 PE=3 SV=2
E0U4V7	1.92e-07	426	520	2	102	Poly(ribitol-phosphate) beta-glucosyltransferase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000489_00125.