CAZyme Information: MGYG000000489_00846

Basic Information

• Species: Agathobacter sp900548765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900548765
• CAZyme ID: MGYG000000489_00846
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	MGYG000000489_5|CGC2	94656.49	5.0759

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000489	2786257	MAG	Fiji	Oceania

• Gene Location: Start: 44967; End: 47384 Strand: -

Full Sequence      

MDINGMRFYVHKAAAVEENIQTELILIFVLEGEMTLTYQEESYRMKQEDVILINPGLSYE
ISNSQNALYAVTSFSMKLMADVLRTRDMIFYCNSVVDEGHSYQDIRDIFFQLTAEYTSKA
HHTDCYLDSLMLKLLDCLVENYQLNQKSMEAYETENDSRMREIMQYILANLDQEISLNEL
ADQMFVSASTLSRIFKKNTGVYFADYVMQLRVKMALGLLKHSEQNMTQIAMVSGFNNSAS
FNRAFRKTMGITPSEYRDSYRENEAEKEGLEDEQETKIREELKEKGYELGKQETTTRIQL
DMKEKTGHKYHKPWNKMINIGPMWDLNKANVQFHVLQLNEQLHFKYIRMWNIFSQKMMVS
DGKTLGQYNYDGINQVLDFLVQNHLKPFLALGRRPDTALKSDGNEVFFEEQYIYFASKEN
WQDMVDDFIRHIVERYGQEEVSGWIFELDRDCIHADDSTDQGLYYDKDYDFFDAWTYLYE
TLKRRIPEARVGGISSIVVRDWKFMADFFARCREQKVIPDFISFIVFPYDVYMANGNQVV
RKVSQNEYNEENQIREIIRLKQQTGLEELPIYITEWNNSISNRNYLNDSCFRAAYIVKKA
ETIADQVDMLGIMGGTDWVSSHMDTVGIVNGGIGLLTKDMIRKPAYFAVDFLNQLGDYLL
DKGANYIATRKENGDIYILCFYYSWFKRSYFLQEEDVDLRKCSNMFFEDERPIHIEFNIR
NLGEAGEYYIKKRTLNRQNGSILNEWGKFQYDIRLTRQDVKYLQGISFPTLSQSKKKVIN
GDNTLNMKVTLEPHEISLIHIFCRK

Enzyme Prediction     

No EC number prediction in MGYG000000489_00846.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	309	747	1.1e-57	0.9698375870069605

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	2.61e-36	297	801	2	487	Glycosyl hydrolases family 39.
COG2207	AraC	1.02e-30	155	265	17	127	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
COG3664	XynB	8.34e-30	328	802	3	425	Beta-xylosidase [Carbohydrate transport and metabolism].
smart00342	HTH_ARAC	3.43e-28	174	257	1	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	7.51e-24	180	257	1	79	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK46391.1	2.09e-287	3	804	1	800
QQQ92191.1	4.05e-245	23	802	24	797
QJU15301.1	4.05e-245	23	802	24	797
ASU27451.1	4.63e-245	23	802	28	801
ANU74646.2	4.63e-245	23	802	28	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1W91_A	8.17e-37	309	801	13	480	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	3.63e-36	309	801	13	480	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2BFG_A	8.88e-36	309	801	13	480	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
6UQJ_A	7.09e-31	326	655	43	365	Crystalstructure of the GH39 enzyme from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
4M29_A	8.67e-31	340	801	52	496	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	1.20e-34	309	801	13	481	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P36906	1.19e-28	338	801	42	479	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
O30360	9.20e-28	338	801	42	479	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P23552	3.68e-25	309	655	19	356	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
Q936F1	3.19e-24	24	801	23	739	Uncharacterized HTH-type transcriptional regulator OS=Staphylococcus aureus OX=1280 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000489_00846.