CAZyme Information: MGYG000000489_00911

Basic Information

• Species: Agathobacter sp900548765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900548765
• CAZyme ID: MGYG000000489_00911
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925		101953.2	4.7211

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000489	2786257	MAG	Fiji	Oceania

• Gene Location: Start: 122667; End: 125444 Strand: -

Full Sequence      

MSEYAVNQEKYAALARQAVAEGCVLLKNDKETLPIQAGEKIAVFGRAAFNYYKSGLGSGG
LVNTRYVVGILDAIKAEKSIELDSDVLRAYESWLKDNPYDEGQGWGKVPWSQKEMPLDDA
LVEQAAKNNDKAIVIIGRTAGEDQDTFDKPGQYRLSDVELDTIRKVKTGFDKVVVLLNVG
NIIDMKWVDELKPDAVMYVWQGGQEGGNGVCDVLTGRVNPCGSLTDTIACNISDYPSDAN
FGDDEKNYYKEDIYVGYRYFETFARDKVMYPFGYGLSYTTFENKYNLEKPCTICGGDTNK
VTVYVSVKNTGKYPGKETIQVYVKAPNGKLGKAERVLCAYAKTKTLKVGETQELALVILK
KDIASFDDSGATGHKNAFVLEAGEYTVYAGEDVRSAEKIGSFEQDFVVVEQLEEAYAPAE
SFERMCRKEDGSLGMEAVPVRSFGPYDRVEKPAEIAYTGDKGYKLSDVYNNKISLDEFIA
QLSKEDLVSLFRGEGMSSPKVTPGTGSAFGGLTESLRAFGIPAACTTDGPSGLRFDVGTK
AFSLPNGTLLGCTFNDELVEELYSITSRELRRNRVDALLGPGINIHRHPLCGRNFEYISE
DPFLTGKMGAAQIRGLNTVGTTGTIKHFCGNNQESKRHEVMGLISQRALREIYLKGFEMC
VKEANARAVMTTYGPINGVWTAGSYDLNTLILRKEWGFDGIVMSDWWAEANIEGHKSDKR
CRGVMVAAGNDLYKCSSDAADQTQDDVMEELEAGRVTIGQLQRNAKHILGFILKSPAMLY
EMDAISQEELEEIKAVKDDDGEVEITAYMEIDEKGLASIDTSELEVSQGSTVAYGLVTDK
FGDYDIEITAKSSLDELAQLPVTVYLDNKLVETIVFRGSQGKSVIETRKLGNIFGKTHFV
KLYFGAAGLKPEKIEVKYKGNKDGK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	518	732	2e-59	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01915	Glyco_hydro_3_C	2.17e-45	24	257	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
COG1472	BglX	2.99e-45	503	732	40	276	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	4.46e-32	15	403	387	763	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	1.00e-27	460	769	4	314	Glycosyl hydrolase family 3 N terminal domain.
pfam14310	Fn3-like	1.17e-14	317	390	1	68	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ92203.1	0.0	2	923	3	917
ANU74658.1	0.0	2	923	3	917
ASU27463.1	0.0	2	923	3	917
QJU15289.1	0.0	2	923	3	917
QAA31783.1	0.0	1	920	1	915

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	2.30e-274	6	915	31	953	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X42_A	2.75e-67	9	402	322	711	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
2X40_A	2.75e-67	9	402	322	711	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	5.63e-43	513	784	29	303	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.32e-42	514	811	30	334	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	2.10e-307	6	917	4	903	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	2.21e-141	3	732	20	786	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
F6C6C1	2.20e-45	514	807	30	330	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	9.46e-45	514	807	30	330	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
P14002	3.08e-42	513	784	29	303	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000016	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000489_00911.