CAZyme Information: MGYG000000489_01499

Basic Information

• Species: Agathobacter sp900548765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900548765
• CAZyme ID: MGYG000000489_01499
• CAZy Family: CBM61
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185	MGYG000000489_11|CGC1	19880.66	3.6745

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000489	2786257	MAG	Fiji	Oceania

• Gene Location: Start: 70734; End: 71291 Strand: -

Full Sequence      

MKKRVVNSILVVGMLAALTGCGNSEAAKATPDENGNYLTNGSFEEADFDGWTVTNVNDVT
EELDVYDRDTDCVDGVQSLHFYSGSSDVDFTAEQTVEGLEDGTYKLTAYIQGEAAGDDDA
VAYFYAIVDGEEVKVDGELNGYLNWYTAELSGIEPTDGKITVGIKVQTAPGGWGTIDNMS
LVKEQ

Enzyme Prediction     

No EC number prediction in MGYG000000489_01499.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM61	36	181	2.1e-32	0.9858156028368794

CDD Domains     

MGYG000000489_01499 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN97261.1	4.11e-104	1	184	1	185
QNM03635.1	1.82e-96	1	184	1	187
BBF43149.1	9.98e-34	1	183	1	180
ALS74893.1	3.74e-27	36	185	509	655
QDY72601.1	4.81e-26	36	183	668	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XOM_A	2.54e-09	36	185	9	152	Atomicresolution structure of TmCBM61 in complex with beta-1,4- galactotriose [Thermotoga maritima],2XON_A Structure of TmCBM61 in complex with beta-1,4-galactotriose at 1.4 A resolution [Thermotoga maritima],2XON_L Structure of TmCBM61 in complex with beta-1,4-galactotriose at 1.4 A resolution [Thermotoga maritima]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000065	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000489_01499.