CAZyme Information: MGYG000000489_02219

Basic Information

• Species: Agathobacter sp900548765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900548765
• CAZyme ID: MGYG000000489_02219
• CAZy Family: GT113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		34439.51	4.8737

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000489	2786257	MAG	Fiji	Oceania

• Gene Location: Start: 4578; End: 5489 Strand: -

Full Sequence      

MNIHITKTYNIGGLIGLRQNSVRNAAEKMGYKEMSLFRFPDIYDTDDDLNVRMEGITSAL
CPSDIVIFQHPSGESPRYDTFLYEHIKACSGTKIVAFVQEVASRRTNIEYSLQEEIDLLN
RADMYIFASELLRKYYLENGLMEKPYIIQKVSDYLTDISVNRHNGKKLYLMRVADGESNP
NSYADVEVITYDEYHAAEIILKLSEGGMGLICNQDEMALGIYMAAGIPVIIKKGLPGEEY
VTSHKIGLAASDLNDIYRNLMSLTEDSMRTYYDNVKKLQGLFTSGMYTQKLLIDTVLMVK
EML

Enzyme Prediction     

No EC number prediction in MGYG000000489_02219.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	19	294	1.6e-36	0.9440993788819876

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	3.34e-45	1	299	1	333	sugar transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR76247.1	6.92e-140	1	303	1	303
CBK91592.1	9.31e-138	1	303	1	303
CBK92847.1	9.31e-138	1	303	1	303
ARU20066.1	2.98e-42	3	296	5	329
CBK92848.1	4.30e-41	1	301	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	1.30e-34	1	296	3	326	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]
3QKW_A	2.67e-26	1	296	3	326	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	2.98e-26	1	296	11	334	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0M3KKZ0	6.82e-34	1	296	1	324	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2
A0A0H2UR93	4.26e-30	1	296	1	330	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
Q9AEU1	5.71e-30	1	297	1	330	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B5A7L9	1.41e-25	1	296	1	324	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1
B3XPQ7	1.12e-19	1	296	1	329	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000489_02219.