CAZyme Information: MGYG000000490_00053

Basic Information

• Species: UMGS1865 sp900768535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1865; UMGS1865 sp900768535
• CAZyme ID: MGYG000000490_00053
• CAZy Family: GH156
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524		60133.3	5.8485

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000490	2369759	MAG	Fiji	Oceania

• Gene Location: Start: 59986; End: 61560 Strand: -

Full Sequence      

MNQTVPFRSLYSNDTTNLENCTSAYHAKGENFTPEHLRESVREVEGLADVHLIQLAHGQV
PWYQSQIYPFREHLKWWSDYFGVPMETLEALRGCNGYVRDGGDILADFIEACRAYGQAAF
VSVRLNDEHHVEWIDKKGHTNGIHSISRFLAEHRDLMFGGDLQVWANRALNWIHPEVPAH
MLELITEQCENYDIDGLELDFMRYPHLFDLSQTTFAERAAVAERFLAAVRAVLDRTARNS
RHRYLCVRVPSDIGMWDAIGLLPERLQSLGVEMVNVSSSYFTDQWVDFGAFSSRMPNLAV
YFEICHCTTTGTALNSNGYDNFLYRRTTENEIYTTAHMAYRHGAQGLSYFNFAYYREHGS
AGRGPFNEPPFDAIGLAKNREFVAHAPQHFFLAKGWSDKTQLRDPLAGDTVYAFRMYAEP
PADGWKTGFRFRLLTRTPIGTRRFRVTFNGHEPEETDCVKEPYPEDARYRPMHGDAGTLR
AWTVARDAVCPGENRITVEWTSPDTKEPIRVDYMDLFPDEEGKG

Enzyme Prediction     

No EC number prediction in MGYG000000490_00053.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH156	19	499	2.8e-43	0.8695652173913043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	8.48e-04	147	235	94	184	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG1649	YddW	0.007	159	204	169	210	Uncharacterized lipoprotein YddW, UPF0748 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIF01836.1	1.08e-122	6	516	47	556
QHI69840.1	2.91e-91	6	516	24	540
QGJ71964.1	2.56e-78	7	464	44	500
QHI69841.1	3.02e-64	3	516	24	536
AQQ72137.1	2.20e-22	5	393	46	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZD_A	1.45e-13	83	251	84	249	Crystalstructure of an inverting family GH156 exosialidase from uncultured bacterium pG7 [uncultured bacterium pG7],6RZD_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 [uncultured bacterium pG7],6S00_A Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-acetylneuraminic acid [uncultured bacterium pG7],6S00_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-acetylneuraminic acid [uncultured bacterium pG7],6S0E_A Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-Acetyl-2,3-dehydro-2-deoxyneuraminic acid [uncultured bacterium pG7],6S0E_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-Acetyl-2,3-dehydro-2-deoxyneuraminic acid [uncultured bacterium pG7],6S0F_A Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with 3-Deoxy-D-glycero-D-galacto-2-nonulosonic acid [uncultured bacterium pG7],6S0F_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with 3-Deoxy-D-glycero-D-galacto-2-nonulosonic acid [uncultured bacterium pG7]
6S04_A	3.22e-12	83	251	84	249	Crystalstructure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-glycolylneuraminic acid [uncultured bacterium pG7],6S04_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-glycolylneuraminic acid [uncultured bacterium pG7]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999983	0.000096	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000490_00053.