CAZyme Information: MGYG000000490_00549

Basic Information

• Species: UMGS1865 sp900768535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1865; UMGS1865 sp900768535
• CAZyme ID: MGYG000000490_00549
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592		67525.73	5.1751

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000490	2369759	MAG	Fiji	Oceania

• Gene Location: Start: 1250; End: 3028 Strand: +

Full Sequence      

MKQIPRSEYPRPQLVRDAWLCLNGEWEFEIDHGESGEARGLVGAEHLAGKITVPFCPESK
LSGVEHKDFMRCVWYAKNLTVPPEWKGKRILLRFGAVDYLATVWVNGTKVGTHTGGYTPF
AFDITDCLNYENDRVVLSAFDDVRSHNQPGGKQSTRFASYGCSYTRTTGIWQTVWMEAVE
ELHISGVRTTPDVAACAVTVQCRLNGDPIGAGLTVRVTYAGREVGRASAEGILANSVSVT
VPLTEKHLWEVGQGNLYDMELTLTKGETVTDRAASYFGLRSVALVGRTFRINGRVVFGRW
VLDQGFYPDGVYTAPTDDDLKNDILHSMELGFNGARLHEKIFEPRFLYWADRLGYLCWGE
HANWELNITEPGAIEHFLPEWLEAVERDYNHPAIIGWCPFNETWDFRGRRQADSVLMQIY
RVTKALDATRPVIDTSGNFHVETDIYDVHDYEQDPEKFVTYYEKIDEKIVNDQCARSSDR
SRRDRQHYDGKLPVFVSEYGGIRWTKEASGWGYGKGPETEQEFLDRYRGLTDALLDNENI
MGFCYTQLFDVEQEQNGLMTYGREFKFDPALIRAVNTREAAIEKKYNRSDRT

Enzyme Prediction     

No EC number prediction in MGYG000000490_00549.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	15	554	5.4e-97	0.5837765957446809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.97e-39	22	456	15	451	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.45e-37	20	432	13	445	beta-D-glucuronidase; Provisional
PRK10340	ebgA	2.57e-16	51	446	99	486	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	4.66e-15	22	176	4	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK09525	lacZ	3.04e-14	75	432	124	485	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY74929.1	1.93e-246	4	583	7	581
ALS26546.1	2.39e-246	4	585	9	588
SMF87854.1	1.28e-244	4	583	7	581
AYB42891.1	4.82e-244	4	583	6	579
QOT10821.1	1.38e-243	4	583	6	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	7.99e-88	8	585	28	588	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3K4A_A	1.22e-32	22	448	17	464	Crystalstructure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12],3K4A_B Crystal structure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12]
4JHZ_A	2.19e-32	22	448	17	464	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12],4JHZ_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12]
3LPF_A	2.22e-32	22	448	17	464	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPF_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPG_A Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],3LPG_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],5CZK_A Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12],5CZK_B Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12]
6LEM_B	1.28e-31	22	448	13	460	ChainB, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P05804	7.09e-31	22	448	15	462	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
P77989	5.31e-25	65	431	50	411	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
O18835	5.49e-23	9	500	29	541	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
O97524	7.30e-23	9	500	29	541	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
Q4FAT7	3.03e-22	9	500	30	542	Beta-glucuronidase OS=Sus scrofa OX=9823 GN=GUSB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000490_00549.