CAZyme Information: MGYG000000490_00752

Basic Information

• Species: UMGS1865 sp900768535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1865; UMGS1865 sp900768535
• CAZyme ID: MGYG000000490_00752
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		51920.76	6.7356

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000490	2369759	MAG	Fiji	Oceania

• Gene Location: Start: 9822; End: 11219 Strand: +

Full Sequence      

MVYRDGKVEQIKIAYIGGGSRGWGWGLMSDLASCGDMSGDVYLYDIDFPAAQHNEVIGNL
YRNAEGARSVWNYRAVRSAGEALTGADFVVISILPGNFDDMESDVHTPEKYGIYQSVGDT
TGPGGTVRAMRTVPMYEEIAANIRRYCPDAWVISYTNPMTLCVKTLYRVFPKIRAFGCCH
EVFGTQKALAVALRKCRGEEAERHEIKVNPVGVNHFTWLTDARYRNLDLFPVWREFAERY
AATGYTENLDKNWMNNSFSCSNRVKFDLFLRYGVIAAAGDRHLAEFCEGGWYLRDPETVR
RWGFGLTGVKWRRADLEKRLAKSEGYRNGSIPVTIEKTGEEGTEQMRAILGLRELVTNVN
LPNVGQIPNLPLGAVVETNAVFRSGSVTPVFAGNVPQSIYPLVARVSGQQEALSDAIARR
SGRDVFNVFLNDPLTTCSYDDAGQLFREMVANTARYLSSYDLTGI

Enzyme Prediction     

No EC number prediction in MGYG000000490_00752.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	191	1.6e-53	0.9832402234636871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	8.37e-128	11	449	1	419	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	5.23e-89	10	457	3	436	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	3.66e-52	27	460	18	430	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	1.19e-47	12	193	1	181	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	1.93e-43	41	457	32	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ85649.1	2.13e-200	1	457	1	458
QEH67112.1	2.01e-198	1	457	1	458
SNX53414.1	5.74e-198	1	462	1	463
AFK85236.1	5.02e-197	1	462	1	463
ADL69889.1	3.33e-195	1	462	1	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	9.92e-145	7	448	2	434	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	3.22e-21	43	460	36	437	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	4.43e-21	5	416	2	397	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1U8X_X	4.28e-17	73	430	90	435	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
6DUX_A	3.82e-14	82	240	77	229	ChainA, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DUX_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_A Chain A, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	1.00e-197	1	462	1	463	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	4.40e-174	1	460	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
A9KTB9	6.45e-162	1	457	1	460	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
P39130	6.87e-149	2	450	1	440	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	3.61e-36	12	460	3	431	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000490_00752.