CAZyme Information: MGYG000000490_01077

Basic Information

• Species: UMGS1865 sp900768535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1865; UMGS1865 sp900768535
• CAZyme ID: MGYG000000490_01077
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524	MGYG000000490_32|CGC1	58822.27	6.423

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000490	2369759	MAG	Fiji	Oceania

• Gene Location: Start: 11696; End: 13270 Strand: -

Full Sequence      

MKKAIRHERGPAILPLTPAPERKRAGKAKGAPAPAEVSVMAEAPEAGKKKILFVGAEVMP
FAATGGLGDVLGSLPAALAGTGQVDVRVVMPLYGSISQAWRAQMKEEYITSVRLAWREQY
CGIYSLVKDGVTYYFIDNEYYFRRPALYGFYDDGERYAYFCLAVLEMMNRLNYYPDILHA
HDWQAALSVVYLNCLYRSRPWYGTMRTVFTIHNIEYQGQYDFAILGDVFALSGNEHALME
YNGCINLMKAAIECADRVTTVSPRYAWEIRTPEYAHGLDAALNRNAGKLSGILNGIDYTY
YDPATDPCIAARYSVQNMEGKGADKLALQRETGLPERADVPMLAVISRLAAHKGLDLITG
CIYDLVAAHELQLVILGKGEFGFESFFRELQERFPDKVRALITYDRDLSKRVYAAADIFL
MPSRSEPCGLSQMIASRYGAIPVVRETGGLYDSIKPYWVEGETLHGNGFTFANYSAAELR
ERTEAAIGVWYSKPERDRLVERVMTTDFSWRRSAGQYLELYEGI

Enzyme Prediction     

No EC number prediction in MGYG000000490_01077.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	50	522	1.1e-169	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	50	524	2	478	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	50	524	2	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	50	524	2	463	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	50	523	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14099	PRK14099	3.18e-114	50	521	5	476	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGX05960.1	8.40e-157	50	524	2	474
BCI60006.1	6.13e-156	50	524	2	472
QNK41915.1	1.23e-155	50	524	2	471
QEY34691.1	5.85e-154	50	521	2	468
CAB1243454.1	1.13e-153	50	521	2	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	9.21e-84	49	522	125	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	3.22e-82	50	521	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.11e-81	50	521	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	8.54e-81	50	521	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	8.54e-80	40	521	1	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4IS20	9.44e-151	50	522	2	472	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
O08328	3.79e-150	50	522	2	472	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
B7GK04	3.22e-143	50	522	2	472	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1
Q1WSN1	5.64e-142	50	521	2	472	Glycogen synthase OS=Ligilactobacillus salivarius (strain UCC118) OX=362948 GN=glgA PE=3 SV=1
Q65FS7	5.89e-141	50	521	2	472	Glycogen synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000490_01077.