CAZyme Information: MGYG000000490_01557

Basic Information

• Species: UMGS1865 sp900768535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1865; UMGS1865 sp900768535
• CAZyme ID: MGYG000000490_01557
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637	MGYG000000490_70|CGC1	72511.08	5.2308

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000490	2369759	MAG	Fiji	Oceania

• Gene Location: Start: 6409; End: 8322 Strand: +

Full Sequence      

MKPFWIWLQEADTDDSYGEFYTSFDWSAGEAELRISADSDYTLFLNGQFVDSDQYKDFPW
CKVYDRLNITPYLRRGVNHMAVVVWHYGVGNFSYCPGPAGLWYEVTVAGTPIAVSGRETR
SRLSRAYRSHAKKNITFQLGFSFFYRADREDGWRSGDLQGFAESRVLDLPAPAIPRPVRK
LNVLPRIPCRLVRREGNRRLFDLGHEEVGYLTLSVRSAVPQELKIAWGEHIADGWVRYRI
GDRDFSAGVFVGAGTTQYSNCFRRLGARYLELISEAELEVEYLSLLPCPYPLQKAPVSFG
DAQTDRIYAVAVRTLELCMHDHYEDCPWREQAMYAMDSRNQMLCGYYAFREFAFPRACLW
LMGQDRRADGLLSICTPENLGNAIPSFSLHYILALYEYTLHSGDLTLAKEVLPRAETILA
AYLCRMKDGLVPTFTGAGYWNFYEWRDELDGKGSGERFDAVLNCLLSLALDRMQRLCALL
QIDRDEQPRIASLNRRIAEMFYVPEKNRFRNRSDSYGYSELANALAVLCGAAEGSIARDI
AGQLASDSNGMTPVSLSMTCFLYDALLQVDRAAYRDYVLEDIRRTYQPMLDAGATSFWET
ELGEADFHNAGSLCHGWSAMPVYYYHTLLPATAPDGE

Enzyme Prediction     

No EC number prediction in MGYG000000490_01557.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	196	626	4.6e-64	0.8551587301587301
CBM67	5	130	6.4e-19	0.7556818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.41e-12	306	626	15	337	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95627.1	1.01e-144	5	628	13	707
QNK57365.1	1.67e-120	1	634	1	718
QGQ97405.1	1.32e-115	2	634	8	719
ARN56684.1	3.13e-100	2	634	22	717
AVM43288.1	8.94e-92	2	635	5	660

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.54e-30	173	624	411	871	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	9.35e-18	196	624	92	537	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
3CIH_A	2.51e-14	268	623	274	630	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000490_01557.