CAZyme Information: MGYG000000491_00199

Basic Information

• Species: Zag111 sp003258735
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111; Zag111 sp003258735
• CAZyme ID: MGYG000000491_00199
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		42447.67	8.2023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000491	2014387	MAG	Fiji	Oceania

• Gene Location: Start: 205720; End: 206844 Strand: -

Full Sequence      

MKKLFIITGEYSGDIHAANVVRELKALDFDLQIEGIGGINLEKEGVKLFATQEKMSAMGI
SPKIIVDHFKLGKSVVDYLKNEYKPDLVLLIDYGAFNLSVAGFLHAAGIKIFYYIPPQVW
ASRKYRINLIKKFVDKVLCIFPFEKQLYAQYGIDTHYCGHPLVSQLPPAAGKREFFRNHG
LDIEKKLVSVFPGSRKFELENLMGVFKETVKRLQHRHPDLQFCISQAPNLSDEIYNKYLG
DCDIKVIKGENQALLSVSDALILASGTVALEACLYKTPMIIAYRGPWILYLGYLLLRCIK
RVSLPNIIADKSIVPEIIQKDVTPLNITYEIEELLYNQDRREKNIKELGEVKELLSNKNS
ALEVAKVIDTELFS

Enzyme Prediction     

No EC number prediction in MGYG000000491_00199.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	355	2.5e-105	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.52e-122	1	371	1	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.34e-105	1	368	1	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.82e-75	4	364	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.09e-64	6	355	10	365	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.02e-46	1	369	1	345	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	9.58e-185	1	374	1	374
AKQ33376.1	6.87e-73	2	367	6	371
ACJ20785.1	1.44e-71	2	374	4	376
EAX32940.1	1.44e-71	2	374	4	376
ATN86369.1	1.44e-71	2	374	4	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.81e-46	6	337	11	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	4.97e-46	6	337	11	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6J9H1	2.87e-72	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
B6J161	1.14e-71	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9NCA7	1.60e-71	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1
A9KC41	1.60e-71	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
Q83DS5	1.60e-71	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000491_00199.