CAZyme Information: MGYG000000491_00231

Basic Information

• Species: Zag111 sp003258735
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111; Zag111 sp003258735
• CAZyme ID: MGYG000000491_00231
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229		24792.21	10.701

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000491	2014387	MAG	Fiji	Oceania

• Gene Location: Start: 235751; End: 236440 Strand: +

Full Sequence      

MRKLLLFTIALVFFLCAPVQAANVSTVKAAIVKHSIEMGVDPAIALSIAKTESGFRHEAR
SSHGAVGVFQLMPSTARRMGLNPYSLDDNIKGGIMYYKSMYKMFGSVELALAAYNAGPAN
VKKYRSVPPFGETRRFVSKIMTDYNHLKAHPDPAMIAARKGYPTIAQKSPAVISSGARGI
AKSPTVIAKTPVKAAPLPMAKIEQSRNLNVELLKGRPMEMDVKSQSVAI

Enzyme Prediction     

No EC number prediction in MGYG000000491_00231.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	39	148	3.7e-28	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	9.53e-41	28	145	5	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	3.02e-37	42	145	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.53e-34	28	144	7	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	5.86e-27	31	149	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	4.32e-24	39	134	9	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39353.1	6.25e-87	1	229	1	216
AZT90545.1	3.45e-31	20	141	94	210
ALF17355.1	1.17e-30	18	145	38	167
ABP67307.1	1.91e-30	20	141	94	210
ADL42254.1	6.94e-30	37	141	101	206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	6.48e-13	24	143	413	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	6.49e-13	24	143	417	555	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	6.51e-13	24	143	423	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	6.53e-13	24	143	427	565	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	6.55e-13	24	143	433	571	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.01e-26	26	144	59	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.70e-24	40	145	1435	1542	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.70e-24	40	145	1435	1542	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	1.81e-09	35	158	15	133	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000532	0.802754	0.195965	0.000248	0.000250	0.000231

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000491_00231.