CAZyme Information: MGYG000000492_00305

Basic Information

• Species: RUG410 sp900553115
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; RUG410; RUG410 sp900553115
• CAZyme ID: MGYG000000492_00305
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254	MGYG000000492_2|CGC1	30047.97	9.9309

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000492	1465212	MAG	Fiji	Oceania

• Gene Location: Start: 79577; End: 80341 Strand: +

Full Sequence      

MVKISAYIVTLNEEKRLGKTLQALKKVADEIFVIDSGSTDKTQKIAEKYGAKFLFHKWKN
ISAQKHYGQELCQNDWVLSLDADEVLSPELIAEIKEKMKKPTADAYRIKICDMLPGDKKP
RLFAKTYNQVRLYNRKKSNMPDDLTHDRVVVGEGAVVEQLEAKVFHYSYVSLTQTWFKLN
MYTDELVKTAVKEGRYYTRLRLYTEFPRQFLVYYFKKRYFLYGTCGFWMATTYAYFRFLK
IAKWFEWKALNSVK

Enzyme Prediction     

No EC number prediction in MGYG000000492_00305.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	110	8.5e-20	0.6882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	2.21e-66	3	230	1	229	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	1.27e-18	5	142	1	151	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	4.50e-16	1	250	2	253	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd02525	Succinoglycan_BP_ExoA	3.37e-15	3	105	1	113	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd02522	GT_2_like_a	6.79e-15	4	112	1	113	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV39834.1	9.23e-61	4	254	7	258
BBF91714.1	3.78e-58	2	254	9	263
ALA16465.1	7.12e-58	4	246	5	249
BAR98158.1	1.95e-57	4	246	8	252
ALK08554.1	1.95e-57	4	246	8	252

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MSP_A	6.37e-07	4	89	56	144	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSP_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
7MSN_A	7.39e-07	4	89	56	144	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSN_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q92IX8	8.55e-50	3	243	8	258	Uncharacterized glycosyltransferase RC0292 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0292 PE=3 SV=1
Q4UMM0	8.78e-50	1	243	1	253	Uncharacterized glycosyltransferase RF_0337 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0337 PE=3 SV=1
Q68XF1	1.12e-49	1	243	1	253	Uncharacterized glycosyltransferase RT0209 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0209 PE=3 SV=1
Q1RJ60	1.85e-48	3	243	8	258	Uncharacterized glycosyltransferase RBE_0523 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0523 PE=3 SV=1
O05944	2.48e-48	1	243	1	253	Uncharacterized glycosyltransferase RP128 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP218 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
219	241