CAZyme Information: MGYG000000492_00310

Basic Information

• Species: RUG410 sp900553115
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; RUG410; RUG410 sp900553115
• CAZyme ID: MGYG000000492_00310
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		43761.06	9.6679

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000492	1465212	MAG	Fiji	Oceania

• Gene Location: Start: 82575; End: 83729 Strand: +

Full Sequence      

MKYYLIAGEPSGDSLGARLIKALRRKDKNAEFYGVGGEGMQAEGIKSLFNISDLAVMGLA
EVIPSIPRVLRHINETVADIQKVRPDVVVTIDSWSFSARVHKKLRQLKLNIPQVHYVAPQ
VWAWKKKRARTMYKYIDLLLTLFPQEPKYFTPYNLQTEFVGHPVIESEVVNGVKGDFKKR
HHIPEENRLLLVLPGSRHNEVERLLPTFLEVVKQLHERYNDFSFVIPTVSTVAAQVKEMV
KQSGLPIEIVEGTKERHDAFKSGDVAIAASGTVALELAIVDVPHIIAYKVPKLTEWLARH
FIHIQFVNLSNILLGKEIVPELLQQDCCVEKIMYYVEQFMKHKPVYNQQMDGFEKVRKLL
GMGQQTPSDNAAEAIIKTIKNYKK

Enzyme Prediction     

No EC number prediction in MGYG000000492_00310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	360	3.5e-121	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.21e-149	1	381	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.18e-139	1	380	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.18e-104	4	375	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.08e-77	5	332	10	337	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.72e-49	1	381	2	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10250.1	4.22e-175	1	380	5	385
ARJ65449.1	1.13e-112	4	383	9	390
CUW40282.1	5.20e-111	4	383	9	390
BAE51288.1	2.52e-110	1	383	1	385
AXO15096.1	1.23e-107	2	379	11	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.31e-60	5	376	11	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.31e-60	5	376	11	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W4D7	5.03e-111	1	383	1	385	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
B6IST7	5.00e-103	4	379	7	383	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q5FUA3	1.32e-86	4	376	32	402	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q0BS63	1.36e-80	4	379	7	367	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
Q1QMM4	3.22e-76	2	379	12	389	Lipid-A-disaccharide synthase OS=Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14) OX=323097 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000492_00310.