CAZyme Information: MGYG000000492_00764

Basic Information

• Species: RUG410 sp900553115
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; RUG410; RUG410 sp900553115
• CAZyme ID: MGYG000000492_00764
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674	MGYG000000492_5|CGC1	77197.63	7.7138

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000492	1465212	MAG	Fiji	Oceania

• Gene Location: Start: 40891; End: 42915 Strand: +

Full Sequence      

MKTRPISAAQITFRRILIFGLMILTTMFLTFKWVVSMPTDANTAARTIMTLLFILTTGWI
ALFFWASIFGFFELLANKSMPGIIWPEKKTPLKTKTAILMPIYNEECDMVYARLLAIADS
LVKTGQAQAYDMFVLSDTTNPKIWIEEENGWINAKKLMPKEINLYYRRRPQNIARKSGNI
EDFCHKWGALYDYMVVLDADSLLEGKTIVEMSRLMELNSDTGIIQAPPQCINSRSLFARV
QQFAGKVYGNIVSAGLCFWQVHDSNYWGHNAIIRIKAFMECCGLPVLKGPKPFGGHILSH
DFVEAALIRRGGWYAWLLPELGGSYEECPPTMIDFATRDRRWCQGNIQHLEILVSKHIHP
ISRIHFTIGIMSYLSSPLWFIFLVSGILVALGHVYFPPEYFSTEQSLFPNWPIFDKMGTI
TLFLISMFMLIFPKFLGMIIYLKNNKFKNIGGFFGTIKSVLAEIVFSALIAPIMMIFQTK
FVWEILTGQDVGWNTQSRDGYTTWKEAFQRHISHTILGVLTTYVVYDQLPALFYWMLPVT
LGLMLSIPLSVLSSYEGLGRFAFKHNWFVIPEEKHIPEITATVQKEAPILMKQSKKRGVL
DVIEDNYLLQIHTLMLEVNGPAPDFGKTVLDEAKIKLDNYLNYGKEPNFSREEEIALLYE
PEVLEEASLELKLK

Enzyme Prediction     

No EC number prediction in MGYG000000492_00764.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2943	MdoH	0.0	2	664	52	712	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
PRK05454	PRK05454	0.0	12	568	39	599	glucans biosynthesis glucosyltransferase MdoH.
cd04191	Glucan_BSP_MdoH	4.78e-148	96	349	1	254	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
cd06421	CESA_CelA_like	3.00e-15	97	350	4	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06423	CESA_like	2.61e-13	98	283	1	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO00644.1	1.90e-196	1	669	1	668
ADO71363.1	8.75e-185	1	667	1	666
ATB33264.1	2.32e-184	52	667	52	666
QDE96388.1	5.29e-184	1	667	1	667
QDE67540.1	5.29e-184	1	667	1	667

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0HJ63	1.56e-165	14	617	56	658	Glucans biosynthesis glucosyltransferase H OS=Shewanella sp. (strain MR-4) OX=60480 GN=opgH PE=3 SV=1
Q0HUS0	4.40e-165	43	617	85	658	Glucans biosynthesis glucosyltransferase H OS=Shewanella sp. (strain MR-7) OX=60481 GN=opgH PE=3 SV=1
A0KWF0	8.77e-165	43	617	85	658	Glucans biosynthesis glucosyltransferase H OS=Shewanella sp. (strain ANA-3) OX=94122 GN=opgH PE=3 SV=1
Q8EF78	1.75e-164	14	617	56	658	Glucans biosynthesis glucosyltransferase H OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=opgH PE=3 SV=1
B8E7D2	3.91e-163	14	617	56	658	Glucans biosynthesis glucosyltransferase H OS=Shewanella baltica (strain OS223) OX=407976 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35
50	72
373	395
420	442
454	476
531	553