CAZyme Information: MGYG000000493_00559

Basic Information

• Species: UBA2883 sp002103075
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA2883; UBA2883 sp002103075
• CAZyme ID: MGYG000000493_00559
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000000493_3|CGC1	42525.67	9.1287

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000493	1815977	MAG	Fiji	Oceania

• Gene Location: Start: 66353; End: 67474 Strand: +

Full Sequence      

MKKLFIITGEYSGSMHATKVVECLKEQNSDLQIEGIGDKNLENAGVKLFADHSKMSAVGL
NFSILFNHIMLGKRVVDYLTKEYKPDMVLLIDYGAFNTKVAGFLKKAGIKVFYYIPPQVW
ATRKHRIKELKKNVDKVLCIFPFEVELYKSYGIDVHYCGHPLVKQLPEKANRDAFFEKYG
IDRDKKLVSIFPGSRSFELKYLMKTFIKSAKILKKSHPDIQFLISHAPNLSDEVYNKYLG
NDDTFKVIKGDNHALLSVSDALILASGTVALEAALYEVPMIISYKGPELFYWIYLLVRCI
SRVALPNIILDKTVVPELVQHKSNPKMISSEIEKLLYDEEYRNNHIAGLSQVKEKLSDKY
SAQEVANIILENI

Enzyme Prediction     

No EC number prediction in MGYG000000493_00559.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	356	5.5e-105	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.20e-115	1	369	1	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.18e-100	1	371	1	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.95e-76	4	365	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.69e-71	6	369	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.18e-43	1	371	1	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	2.50e-182	1	371	1	370
AKQ33376.1	3.07e-80	2	373	6	376
QTS83715.1	2.71e-76	2	371	6	374
QPK65076.1	7.74e-74	9	371	15	379
AEH45383.1	5.00e-73	3	368	10	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.39e-48	6	336	11	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	6.14e-48	6	336	11	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	2.23e-73	2	371	7	378	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B6J161	4.99e-73	2	369	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q83DS5	7.03e-73	2	369	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
B6J9H1	7.03e-73	2	369	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
A9KC41	7.03e-73	2	369	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000493_00559.