CAZyme Information: MGYG000000493_01347

Basic Information

• Species: UBA2883 sp002103075
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA2883; UBA2883 sp002103075
• CAZyme ID: MGYG000000493_01347
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538	MGYG000000493_10|CGC1	62059.4	10.0184

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000493	1815977	MAG	Fiji	Oceania

• Gene Location: Start: 5887; End: 7503 Strand: +

Full Sequence      

MKEFVLKHKKIFFIMMIIVGVYLLYFHNIWMYKLLDVDETRYVNMSSTMFHDKEFMTLYL
NGKFFFEKPPLYFWIENLFFGLFGGVSEGVARIPIGLQSLFAALAVYFAGAKVVSKKFGL
IVACILGTSLEFIIMSKIAILDMLLTSCITISVFSGFMTYFVQEQNKKYFWWLFYIFSGL
AVMAKGIPGVVVPFGVMFFAGLYAKNLKEFFKPKYFGLGTLLFLLIVLPWHIAMLHIHGK
LFFDEYIIKHHLLRFIGSDVIHRERPFLFYIPILAWGFFPWVFSFVSMLVEKCRGFRYRA
YETLENKDRFVALSIIGALFTMLFFSVSGTKLVTYILPVYPFLAVILANYWCEDGCSKIF
KVFSQVLNSILILVGFVILIARSYLPFDLYNTVSELKFVGMSLCIVAGGLGVVFAKDGKK
LKLFTVYTVLMVLLSAFGTHHFFNINAKFGQNDLIEYAQIAKAQNKKIVGYKTGKKYSLI
YYSGAKRVLFLGEDDEYLVPQYLNNKSNLVIIKNKDFKKLKFKYTVVKKGVKYSIVSK

Enzyme Prediction     

No EC number prediction in MGYG000000493_01347.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	12	506	9.3e-98	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.50e-39	6	438	5	428	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	5.71e-26	6	385	3	366	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	6.38e-08	10	235	1	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	2.20e-07	68	199	2	129	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38667.1	2.00e-149	3	536	6	554
QCT94029.1	2.54e-45	7	345	4	329
AIF51770.1	2.92e-44	26	350	21	324
AJQ27709.1	2.82e-43	23	355	18	333
ACD96977.1	1.85e-42	34	349	39	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	9.14e-18	25	346	45	359	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.84e-28	15	359	6	329	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q2NWA9	1.60e-22	38	410	33	397	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT1 PE=3 SV=1
O67601	7.18e-20	30	374	21	325	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
Q6D2F3	1.19e-19	22	400	21	395	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1
C6DAW3	3.74e-19	22	350	21	334	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	31
89	111
118	135
140	162
169	183
187	204
216	238
267	289
310	329
333	352
359	381
396	414
421	443